Recombinant Human CLTB Protein, GST-tagged
Cat.No. : | CLTB-1525H |
Product Overview : | Human CLTB full-length ORF ( AAH06457, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 48.95 kDa |
AA Sequence : | MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLTB clathrin, light chain B [ Homo sapiens ] |
Official Symbol | CLTB |
Synonyms | CLTB; clathrin, light chain B; clathrin, light polypeptide (Lcb); clathrin light chain B; Lcb; clathrin, light chain (Lcb); LCB; |
Gene ID | 1212 |
mRNA Refseq | NM_001834 |
Protein Refseq | NP_001825 |
MIM | 118970 |
UniProt ID | P09497 |
◆ Recombinant Proteins | ||
CLTB-801H | Recombinant Human CLTB Protein, His-tagged | +Inquiry |
CLTB-1470R | Recombinant Rat CLTB Protein | +Inquiry |
CLTB-1128R | Recombinant Rat CLTB Protein, His (Fc)-Avi-tagged | +Inquiry |
CLTB-3044H | Recombinant Human Clathrin, Light Chain B, His-tagged | +Inquiry |
CLTB-1525H | Recombinant Human CLTB Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLTB-7426HCL | Recombinant Human CLTB 293 Cell Lysate | +Inquiry |
CLTB-7427HCL | Recombinant Human CLTB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLTB Products
Required fields are marked with *
My Review for All CLTB Products
Required fields are marked with *