Recombinant Human CLTB Protein, GST-tagged

• Cat.No.: CLTB-1525H
• Product Overview: Human CLTB full-length ORF ( AAH06457, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]
• Molecular Mass: 48.95 kDa
• AA Sequence: MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLTB clathrin, light chain B [ Homo sapiens ]
• Official Symbol: CLTB
• Synonyms: CLTB; clathrin, light chain B; clathrin, light polypeptide (Lcb); clathrin light chain B; Lcb; clathrin, light chain (Lcb); LCB
• Gene ID: 1212
• mRNA Refseq: NM_001834
• Protein Refseq: NP_001825
• MIM: 118970
• UniProt ID: P09497