Recombinant Human CMSS1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CMSS1-4892H
• Product Overview: C3orf26 MS Standard C13 and N15-labeled recombinant protein (NP_115735) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: CMSS1 (Cms1 Ribosomal Small Subunit Homolog) is a Protein Coding gene. Diseases associated with CMSS1 include Refractive Error and Degenerative Myopia. Gene Ontology (GO) annotations related to this gene include nucleic acid binding.
• Molecular Mass: 31.8 kDa
• AA Sequence: MADDLGDEWWENQPTGAGSSPEASDGEGEGDTEVMQQETVPVPVPSEKTKQPKECFLIQPKERKENTTKTRKRRKKKITDVLAKSEPKPGLPEDLQKLMKDYYSSRRLVIELEELNLPDSCFLKANDLTHSLSSYLKGICPKWVKLRKNHSEKKSVLMLIICSSAVRALELIRSMTAFRGDGKVIKLFAKHIKVQAQVKLLEKRVVHLGVGTPGRIKELVKQGGLNLSPLKFLVFDWNWRDQKLRRMMDIPEIRKEVFELLEMGVLSLCKSESLKLGLFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CMSS1 cms1 ribosomal small subunit homolog [ Homo sapiens (human) ]
• Official Symbol: CMSS1
• Synonyms: CMSS1; cms1 ribosomal small subunit homolog; C3orf26; protein CMSS1
• Gene ID: 84319
• mRNA Refseq: NM_032359
• Protein Refseq: NP_115735
• UniProt ID: Q9BQ75