Recombinant Human CMSS1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CMSS1-4892H
Product Overview : C3orf26 MS Standard C13 and N15-labeled recombinant protein (NP_115735) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : CMSS1 (Cms1 Ribosomal Small Subunit Homolog) is a Protein Coding gene. Diseases associated with CMSS1 include Refractive Error and Degenerative Myopia. Gene Ontology (GO) annotations related to this gene include nucleic acid binding.
Molecular Mass : 31.8 kDa
AA Sequence : MADDLGDEWWENQPTGAGSSPEASDGEGEGDTEVMQQETVPVPVPSEKTKQPKECFLIQPKERKENTTKTRKRRKKKITDVLAKSEPKPGLPEDLQKLMKDYYSSRRLVIELEELNLPDSCFLKANDLTHSLSSYLKGICPKWVKLRKNHSEKKSVLMLIICSSAVRALELIRSMTAFRGDGKVIKLFAKHIKVQAQVKLLEKRVVHLGVGTPGRIKELVKQGGLNLSPLKFLVFDWNWRDQKLRRMMDIPEIRKEVFELLEMGVLSLCKSESLKLGLFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CMSS1 cms1 ribosomal small subunit homolog [ Homo sapiens (human) ]
Official Symbol CMSS1
Synonyms CMSS1; cms1 ribosomal small subunit homolog; C3orf26; protein CMSS1
Gene ID 84319
mRNA Refseq NM_032359
Protein Refseq NP_115735
UniProt ID Q9BQ75

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CMSS1 Products

Required fields are marked with *

My Review for All CMSS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon