Recombinant Human CNN3 Protein (2-329 aa), His-tagged
Cat.No. : | CNN3-416H |
Product Overview : | Recombinant Human CNN3 Protein (2-329 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-329 aa |
Description : | Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 40.3 kDa |
AA Sequence : | THFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | CNN3 calponin 3, acidic [ Homo sapiens ] |
Official Symbol | CNN3 |
Synonyms | CNN3; calponin 3, acidic; calponin-3; |
Gene ID | 1266 |
mRNA Refseq | NM_001839 |
Protein Refseq | NP_001830 |
MIM | 602374 |
UniProt ID | Q15417 |
◆ Recombinant Proteins | ||
CNN3-762R | Recombinant Rhesus Macaque CNN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CNN3-680HFL | Recombinant Full Length Human CNN3 Protein, C-Flag-tagged | +Inquiry |
CNN3-629H | Recombinant Human CNN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CNN3-100HF | Recombinant Full Length Human CNN3 Protein | +Inquiry |
CNN3-1569H | Recombinant Human CNN3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNN3-7404HCL | Recombinant Human CNN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNN3 Products
Required fields are marked with *
My Review for All CNN3 Products
Required fields are marked with *
0
Inquiry Basket