Recombinant Full Length Human COMMD4 Protein, GST-tagged
Cat.No. : | COMMD4-1942HF |
Product Overview : | Human COMMD4 full-length ORF ( NP_060298.2, 1 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 199 amino acids |
Description : | COMMD4 (COMM Domain Containing 4) is a Protein Coding gene. |
Molecular Mass : | 48.2 kDa |
AA Sequence : | MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLMSSLG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COMMD4 COMM domain containing 4 [ Homo sapiens ] |
Official Symbol | COMMD4 |
Synonyms | COMMD4; COMM domain containing 4; COMM domain-containing protein 4; FLJ20452 |
Gene ID | 54939 |
mRNA Refseq | NM_017828 |
Protein Refseq | NP_060298 |
MIM | 616701 |
UniProt ID | Q9H0A8 |
◆ Recombinant Proteins | ||
COMMD4-5012C | Recombinant Chicken COMMD4 | +Inquiry |
COMMD4-4574Z | Recombinant Zebrafish COMMD4 | +Inquiry |
COMMD4-1877M | Recombinant Mouse COMMD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
COMMD4-1942HF | Recombinant Full Length Human COMMD4 Protein, GST-tagged | +Inquiry |
COMMD4-1206H | Recombinant Human COMMD4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COMMD4 Products
Required fields are marked with *
My Review for All COMMD4 Products
Required fields are marked with *