Recombinant Human COMMD4 Protein (1-195 aa), GST-tagged

• Cat.No.: COMMD4-1210H
• Product Overview: Recombinant Human COMMD4 Protein (1-195 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-195 aa
• Description: May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes . Down-regulates activation of NF-kappa-B.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 48.4 kDa
• AA Sequence: MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLM
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: COMMD4 COMM domain containing 4 [ Homo sapiens ]
• Official Symbol: COMMD4
• Synonyms: COMMD4; COMM domain containing 4; FLJ20452
• Gene ID: 54939
• mRNA Refseq: NM_017828
• Protein Refseq: NP_060298
• UniProt ID: Q9H0A8