Recombinant Human COMMD4 Protein (1-195 aa), GST-tagged

Cat.No. : COMMD4-1210H
Product Overview : Recombinant Human COMMD4 Protein (1-195 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-195 aa
Description : May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes . Down-regulates activation of NF-kappa-B.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 48.4 kDa
AA Sequence : MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLM
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name COMMD4 COMM domain containing 4 [ Homo sapiens ]
Official Symbol COMMD4
Synonyms COMMD4; COMM domain containing 4; FLJ20452;
Gene ID 54939
mRNA Refseq NM_017828
Protein Refseq NP_060298
UniProt ID Q9H0A8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COMMD4 Products

Required fields are marked with *

My Review for All COMMD4 Products

Required fields are marked with *

0
cart-icon
0
compare icon