Recombinant Human COMMD4 Protein (1-195 aa), GST-tagged
Cat.No. : | COMMD4-1210H |
Product Overview : | Recombinant Human COMMD4 Protein (1-195 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-195 aa |
Description : | May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes . Down-regulates activation of NF-kappa-B. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 48.4 kDa |
AA Sequence : | MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLM |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | COMMD4 COMM domain containing 4 [ Homo sapiens ] |
Official Symbol | COMMD4 |
Synonyms | COMMD4; COMM domain containing 4; FLJ20452; |
Gene ID | 54939 |
mRNA Refseq | NM_017828 |
Protein Refseq | NP_060298 |
UniProt ID | Q9H0A8 |
◆ Recombinant Proteins | ||
COMMD4-3764M | Recombinant Mouse COMMD4 Protein | +Inquiry |
COMMD4-1206H | Recombinant Human COMMD4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
COMMD4-5011C | Recombinant Chicken COMMD4 | +Inquiry |
COMMD4-5012C | Recombinant Chicken COMMD4 | +Inquiry |
Commd4-2249M | Recombinant Mouse Commd4 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COMMD4 Products
Required fields are marked with *
My Review for All COMMD4 Products
Required fields are marked with *
0
Inquiry Basket