Recombinant Full Length Human COMTD1 Protein, GST-tagged
| Cat.No. : | COMTD1-1949HF |
| Product Overview : | Human COMTD1 full-length ORF ( NP_653190.2, 1 a.a. - 262 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 262 amino acids |
| Description : | COMTD1 (Catechol-O-Methyltransferase Domain Containing 1) is a Protein Coding gene. GO annotations related to this gene include O-methyltransferase activity. |
| Molecular Mass : | 55.2 kDa |
| AA Sequence : | MTQPVPRLSVPAALALGSAALGAAFATGLFLGRRCPPWRGRREQCLLPPEDSRLWQYLLSRSMREHPALRSLRLLTLEQPQGDSMMTCEQAQLLANLARLIQAKKALDLGTFTGYSALALALALPADGRVVTCEVDAQPPELGRPLWRQAEAEHKIDLRLKPALETLDELLAAGEAGTFDVAVVDADKENCSAYYERCLQLLRPGGILAVLRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVYISLLPLGDGLTLAFKI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | COMTD1 catechol-O-methyltransferase domain containing 1 [ Homo sapiens ] |
| Official Symbol | COMTD1 |
| Synonyms | COMTD1; catechol-O-methyltransferase domain containing 1; catechol O-methyltransferase domain-containing protein 1; FLJ23841 |
| Gene ID | 118881 |
| mRNA Refseq | NM_144589 |
| Protein Refseq | NP_653190 |
| UniProt ID | Q86VU5 |
| ◆ Recombinant Proteins | ||
| COMTD1-1689H | Recombinant Human COMTD1 Protein, GST-tagged | +Inquiry |
| COMTD1-794R | Recombinant Rhesus Macaque COMTD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| COMTD1-1949HF | Recombinant Full Length Human COMTD1 Protein, GST-tagged | +Inquiry |
| RFL31530HF | Recombinant Full Length Human Catechol O-Methyltransferase Domain-Containing Protein 1(Comtd1) Protein, His-Tagged | +Inquiry |
| COMTD1-969R | Recombinant Rhesus monkey COMTD1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| COMTD1-7364HCL | Recombinant Human COMTD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COMTD1 Products
Required fields are marked with *
My Review for All COMTD1 Products
Required fields are marked with *



