Recombinant Human COMTD1 Protein, GST-tagged

• Cat.No.: COMTD1-1689H
• Product Overview: Human COMTD1 full-length ORF ( NP_653190.2, 1 a.a. - 262 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: COMTD1 (Catechol-O-Methyltransferase Domain Containing 1) is a Protein Coding gene. GO annotations related to this gene include O-methyltransferase activity.
• Molecular Mass: 55.2 kDa
• AA Sequence: MTQPVPRLSVPAALALGSAALGAAFATGLFLGRRCPPWRGRREQCLLPPEDSRLWQYLLSRSMREHPALRSLRLLTLEQPQGDSMMTCEQAQLLANLARLIQAKKALDLGTFTGYSALALALALPADGRVVTCEVDAQPPELGRPLWRQAEAEHKIDLRLKPALETLDELLAAGEAGTFDVAVVDADKENCSAYYERCLQLLRPGGILAVLRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVYISLLPLGDGLTLAFKI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COMTD1 catechol-O-methyltransferase domain containing 1 [ Homo sapiens ]
• Official Symbol: COMTD1
• Synonyms: COMTD1; catechol-O-methyltransferase domain containing 1; catechol O-methyltransferase domain-containing protein 1; FLJ23841
• Gene ID: 118881
• mRNA Refseq: NM_144589
• Protein Refseq: NP_653190
• UniProt ID: Q86VU5