Recombinant Human COMTD1 Protein, GST-tagged
Cat.No. : | COMTD1-1689H |
Product Overview : | Human COMTD1 full-length ORF ( NP_653190.2, 1 a.a. - 262 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | COMTD1 (Catechol-O-Methyltransferase Domain Containing 1) is a Protein Coding gene. GO annotations related to this gene include O-methyltransferase activity. |
Molecular Mass : | 55.2 kDa |
AA Sequence : | MTQPVPRLSVPAALALGSAALGAAFATGLFLGRRCPPWRGRREQCLLPPEDSRLWQYLLSRSMREHPALRSLRLLTLEQPQGDSMMTCEQAQLLANLARLIQAKKALDLGTFTGYSALALALALPADGRVVTCEVDAQPPELGRPLWRQAEAEHKIDLRLKPALETLDELLAAGEAGTFDVAVVDADKENCSAYYERCLQLLRPGGILAVLRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVYISLLPLGDGLTLAFKI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COMTD1 catechol-O-methyltransferase domain containing 1 [ Homo sapiens ] |
Official Symbol | COMTD1 |
Synonyms | COMTD1; catechol-O-methyltransferase domain containing 1; catechol O-methyltransferase domain-containing protein 1; FLJ23841; |
Gene ID | 118881 |
mRNA Refseq | NM_144589 |
Protein Refseq | NP_653190 |
UniProt ID | Q86VU5 |
◆ Recombinant Proteins | ||
COMTD1-7560Z | Recombinant Zebrafish COMTD1 | +Inquiry |
COMTD1-794R | Recombinant Rhesus Macaque COMTD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
COMTD1-3772M | Recombinant Mouse COMTD1 Protein | +Inquiry |
COMTD1-2570H | Recombinant Human COMTD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Comtd1-2255M | Recombinant Mouse Comtd1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COMTD1-7364HCL | Recombinant Human COMTD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COMTD1 Products
Required fields are marked with *
My Review for All COMTD1 Products
Required fields are marked with *