Recombinant Full Length Human COQ4 Protein, GST-tagged

Cat.No. : COQ4-1975HF
Product Overview : Human COQ4 full-length ORF ( AAH11895.1, 1 a.a. - 265 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 265 amino acids
Description : This gene encodes a component of the coenzyme Q biosynthesis pathway. Coenzyme Q, an essential component of the electron transport chain, shuttles electrons between complexes I or II to complex III of the mitochondrial transport chain. This protein appears to play a structural role in stabilizing a complex that contains most of the coenzyme Q biosynthesis enzymes. Mutations in this gene are associated with mitochondrial disorders linked to coenzyme Q deficiency. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015]
Molecular Mass : 56.1 kDa
AA Sequence : MATLLRPVLRRLCGLPGLQRPAAEMPLRARSDGAGPLYSHHLPTSPLQKALLAAGSAAMALYNPYRHDMVAVLGETTGHRTLKVLRDQMRRDPEGAQILQERPRISTSTLDLGKLQSLPEGSLGREYLRFLDVNRVSPDTRAPTRFVDDEELAYVIQRYREVHDMLHTLLGMPTNILGEIVVKWFEAVQTGLPMCILGAFFGPIRLGAQSLQVLVSELIPWAVQNGRRAPCVLNLYYERRWEQSLRALREELGITAPPMHVQGLA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COQ4 coenzyme Q4 [ Homo sapiens (human) ]
Official Symbol COQ4
Synonyms COQ4; coenzyme Q4; Coenzyme Q4; Coenzyme Q Biosynthesis Protein 4 Homolog; Ubiquinone Biosynthesis Protein COQ4 Homolog, Mitochondrial; Coenzyme Q4 Homolog (S. Cerevisiae); Coenzyme Q4 Homolog (Yeast); Coenzyme Q4 Homolog; COQ10D7; CGI-92; ubiquinone biosynthesis protein COQ4 homolog, mitochondrial; coenzyme Q biosynthesis protein 4 homolog; coenzyme Q4 homolog
Gene ID 51117
mRNA Refseq NM_001305942
Protein Refseq NP_001292871
MIM 612898
UniProt ID Q9Y3A0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COQ4 Products

Required fields are marked with *

My Review for All COQ4 Products

Required fields are marked with *

0
cart-icon
0
compare icon