Recombinant Human COQ4 Protein, GST-tagged
| Cat.No. : | COQ4-1717H | 
| Product Overview : | Human COQ4 full-length ORF ( AAH11895.1, 1 a.a. - 265 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | This gene encodes a component of the coenzyme Q biosynthesis pathway. Coenzyme Q, an essential component of the electron transport chain, shuttles electrons between complexes I or II to complex III of the mitochondrial transport chain. This protein appears to play a structural role in stabilizing a complex that contains most of the coenzyme Q biosynthesis enzymes. Mutations in this gene are associated with mitochondrial disorders linked to coenzyme Q deficiency. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015] | 
| Molecular Mass : | 56.1 kDa | 
| AA Sequence : | MATLLRPVLRRLCGLPGLQRPAAEMPLRARSDGAGPLYSHHLPTSPLQKALLAAGSAAMALYNPYRHDMVAVLGETTGHRTLKVLRDQMRRDPEGAQILQERPRISTSTLDLGKLQSLPEGSLGREYLRFLDVNRVSPDTRAPTRFVDDEELAYVIQRYREVHDMLHTLLGMPTNILGEIVVKWFEAVQTGLPMCILGAFFGPIRLGAQSLQVLVSELIPWAVQNGRRAPCVLNLYYERRWEQSLRALREELGITAPPMHVQGLA | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | COQ4 coenzyme Q4 [ Homo sapiens (human) ] | 
| Official Symbol | COQ4 | 
| Synonyms | COQ4; coenzyme Q4; Coenzyme Q4; Coenzyme Q Biosynthesis Protein 4 Homolog; Ubiquinone Biosynthesis Protein COQ4 Homolog, Mitochondrial; Coenzyme Q4 Homolog (S. Cerevisiae); Coenzyme Q4 Homolog (Yeast); Coenzyme Q4 Homolog; COQ10D7; CGI-92; ubiquinone biosynthesis protein COQ4 homolog, mitochondrial; coenzyme Q biosynthesis protein 4 homolog; coenzyme Q4 homolog | 
| Gene ID | 51117 | 
| mRNA Refseq | NM_001305942 | 
| Protein Refseq | NP_001292871 | 
| MIM | 612898 | 
| UniProt ID | Q9Y3A0 | 
| ◆ Recombinant Proteins | ||
| COQ4-1539R | Recombinant Rat COQ4 Protein | +Inquiry | 
| COQ4-6471Z | Recombinant Zebrafish COQ4 | +Inquiry | 
| COQ4-1196R | Recombinant Rat COQ4 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| COQ4-1717H | Recombinant Human COQ4 Protein, GST-tagged | +Inquiry | 
| COQ4-1975HF | Recombinant Full Length Human COQ4 Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| COQ4-385HCL | Recombinant Human COQ4 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COQ4 Products
Required fields are marked with *
My Review for All COQ4 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            