Recombinant Full Length Human CORO6 Protein, GST-tagged

• Cat.No.: CORO6-1988HF
• Product Overview: Human CORO6 full-length ORF ( AAH64514.1, 1 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 237 amino acids
• Description: CORO6 (Coronin 6) is a Protein Coding gene. GO annotations related to this gene include actin filament binding. An important paralog of this gene is CORO1C.
• Molecular Mass: 53.3 kDa
• AA Sequence: MPSPWGWFAVTACGAQRNNFEEPVALQEMDTSNGVLLPFYDPDSSIVYLCGKGDSSIRYFEITDEPPFVHYLNTFSSKEPQRGMGFMPKRGLDVSKCEIARFYKLHERKCEPIIMTVPRKSDLFQDDLYPDTPGPEPALEADEWLSGQDAEPVLISLRDGYVPPKHRELRVTKRNILDVRPPSGPRRSQSASDAPLSQHTLETLLEEIKALRERVQAQEQRITALENMLCELVDGTD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CORO6 coronin 6 [ Homo sapiens ]
• Official Symbol: CORO6
• Synonyms: Clipin-E; CORO6; Coronin-6; Coronin-like protein E; FLJ14871; PP1009; PP1782; PP1881; CORO6
• Gene ID: 84940
• mRNA Refseq: NM_032854.3
• Protein Refseq: NP_116243.2
• UniProt ID: B3KRY9