Recombinant Human CORO6 protein, His-tagged
| Cat.No. : | CORO6-11481H |
| Product Overview : | Recombinant Human CORO6 protein(1-237 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | February 06, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-237 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | MPSPWGWFAVTACGAQRNNFEEPVALQEMDTSNGVLLPFYDPDSSIVYLCGKGDSSIRYFEITDEPPFVHYLNTFSSKEPQRGMGFMPKRGLDVSKCEIARFYKLHERKCEPIIMTVPRKSDLFQDDLYPDTPGPEPALEADEWLSGQDAEPVLISLRDGYVPPKHRELRVTKRNILDVRPPSGPRRSQSASDAPLSQHTLETLLEEIKALRERVQAQEQRITALENMLCELVDGTD |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| MIM-Weblink : |
| Gene Name | CORO6 coronin 6 [ Homo sapiens ] |
| Official Symbol | CORO6 |
| Synonyms | Clipin-E; CORO6; Coronin-6; Coronin-like protein E; FLJ14871; PP1009; PP1782; PP1881; CORO6 |
| Gene ID | 84940 |
| mRNA Refseq | NM_032854.3 |
| Protein Refseq | NP_116243.2 |
| UniProt ID | B3KRY9 |
| ◆ Recombinant Proteins | ||
| CORO6-1324HFL | Recombinant Full Length Human CORO6 Protein, C-Flag-tagged | +Inquiry |
| CORO6-647H | Recombinant Human CORO6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Coro6-2274M | Recombinant Mouse Coro6 Protein, Myc/DDK-tagged | +Inquiry |
| CORO6-1547R | Recombinant Rat CORO6 Protein | +Inquiry |
| CORO6-1728H | Recombinant Human CORO6 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CORO6-193HCL | Recombinant Human CORO6 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CORO6 Products
Required fields are marked with *
My Review for All CORO6 Products
Required fields are marked with *
