Recombinant Full Length Human COX11 Protein, GST-tagged
Cat.No. : | COX11-1993HF |
Product Overview : | Human COX11 full-length ORF ( NP_004366.1, 1 a.a. - 276 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 276 amino acids |
Description : | Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be a heme A biosynthetic enzyme involved in COX formation, according to the yeast mutant studies. However, the studies in Rhodobacter sphaeroides suggest that this gene is not required for heme A biosynthesis, but required for stable formation of the Cu(B) and magnesium centers of COX. This human protein is predicted to contain a transmembrane domain localized in the mitochondrial inner membrane. Multiple transcript variants encoding different isoforms have been found for this gene. A related pseudogene has been found on chromosome 6. [provided by RefSeq, Jun 2009] |
Molecular Mass : | 57.8 kDa |
AA Sequence : | MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCSLRARHPALQPPRRPKSSNPFTRAQEEERRRQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COX11 COX11 cytochrome c oxidase assembly homolog (yeast) [ Homo sapiens ] |
Official Symbol | COX11 |
Synonyms | COX11; COX11 cytochrome c oxidase assembly homolog (yeast); COX11 (yeast) homolog, cytochrome c oxidase assembly protein; cytochrome c oxidase assembly protein COX11, mitochondrial; COX11P; cytochrome c oxidase assembly protein COX11; cytochrome c oxidase subunit 11; COX11 homolog, cytochrome c oxidase assembly protein |
Gene ID | 1353 |
mRNA Refseq | NM_001162861 |
Protein Refseq | NP_001156333 |
MIM | 603648 |
UniProt ID | Q9Y6N1 |
◆ Cell & Tissue Lysates | ||
COX11-7337HCL | Recombinant Human COX11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COX11 Products
Required fields are marked with *
My Review for All COX11 Products
Required fields are marked with *
0
Inquiry Basket