Recombinant Full Length Human COX11 Protein, GST-tagged

Cat.No. : COX11-1993HF
Product Overview : Human COX11 full-length ORF ( NP_004366.1, 1 a.a. - 276 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 276 amino acids
Description : Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be a heme A biosynthetic enzyme involved in COX formation, according to the yeast mutant studies. However, the studies in Rhodobacter sphaeroides suggest that this gene is not required for heme A biosynthesis, but required for stable formation of the Cu(B) and magnesium centers of COX. This human protein is predicted to contain a transmembrane domain localized in the mitochondrial inner membrane. Multiple transcript variants encoding different isoforms have been found for this gene. A related pseudogene has been found on chromosome 6. [provided by RefSeq, Jun 2009]
Molecular Mass : 57.8 kDa
AA Sequence : MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCSLRARHPALQPPRRPKSSNPFTRAQEEERRRQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COX11 COX11 cytochrome c oxidase assembly homolog (yeast) [ Homo sapiens ]
Official Symbol COX11
Synonyms COX11; COX11 cytochrome c oxidase assembly homolog (yeast); COX11 (yeast) homolog, cytochrome c oxidase assembly protein; cytochrome c oxidase assembly protein COX11, mitochondrial; COX11P; cytochrome c oxidase assembly protein COX11; cytochrome c oxidase subunit 11; COX11 homolog, cytochrome c oxidase assembly protein
Gene ID 1353
mRNA Refseq NM_001162861
Protein Refseq NP_001156333
MIM 603648
UniProt ID Q9Y6N1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COX11 Products

Required fields are marked with *

My Review for All COX11 Products

Required fields are marked with *

0
cart-icon
0
compare icon