Recombinant Full Length Arabidopsis Thaliana Cytochrome C Oxidase Assembly Protein Cox11, Mitochondrial(Cox11) Protein, His-Tagged
Cat.No. : | RFL27536AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Cytochrome c oxidase assembly protein COX11, mitochondrial(COX11) Protein (Q8GWR0) (81-287aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (81-287) |
Form : | Lyophilized powder |
AA Sequence : | STHSPSETKSQKMLYYLTAVVFGMVGLTYAAVPLYRTFCQATGYGGTVQRKETVEEKIAR HSESGTVTEREIVVQFNADVADGMQWKFTPTQREVRVKPGESALAFYTAENKSSAPITGV STYNVTPMKAGVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILS YTFFKVSEENTTETVNNNNSVPVQETN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | COX11 |
Synonyms | COX11; At1g02410; T6A9.10; Cytochrome c oxidase assembly protein COX11, mitochondrial |
UniProt ID | Q8GWR0 |
◆ Recombinant Proteins | ||
COX11-1908M | Recombinant Mouse COX11 Protein, His (Fc)-Avi-tagged | +Inquiry |
COX11-3807M | Recombinant Mouse COX11 Protein | +Inquiry |
COX11-5315Z | Recombinant Zebrafish COX11 | +Inquiry |
COX11-806R | Recombinant Rhesus Macaque COX11 Protein, His (Fc)-Avi-tagged | +Inquiry |
COX11-981R | Recombinant Rhesus monkey COX11 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COX11-7337HCL | Recombinant Human COX11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COX11 Products
Required fields are marked with *
My Review for All COX11 Products
Required fields are marked with *
0
Inquiry Basket