Recombinant Full Length Human COX17 Protein, GST-tagged
Cat.No. : | COX17-2000HF |
Product Overview : | Human COX17 full-length ORF ( NP_005685.1, 1 a.a. - 63 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 63 amino acids |
Description : | Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be involved in the recruitment of copper to mitochondria for incorporation into the COX apoenzyme. This protein shares 92% amino acid sequence identity with mouse and rat Cox17 proteins. This gene is no longer considered to be a candidate gene for COX deficiency. A pseudogene COX17P has been found on chromosome 13. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 33.3 kDa |
AA Sequence : | MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COX17 COX17 cytochrome c oxidase assembly homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | COX17 |
Synonyms | COX17; COX17 cytochrome c oxidase assembly homolog (S. cerevisiae); COX17 (yeast) homolog, cytochrome c oxidase assembly protein , COX17 homolog, cytochrome c oxidase assembly protein (S. cerevisiae) , COX17 homolog, cytochrome c oxidase assembly protein (yeast); cytochrome c oxidase copper chaperone; human homolog of yeast mitochondrial copper recruitment; MGC104397; MGC117386 |
Gene ID | 10063 |
mRNA Refseq | NM_005694 |
Protein Refseq | NP_005685 |
MIM | 604813 |
UniProt ID | Q14061 |
◆ Recombinant Proteins | ||
COX17-3810M | Recombinant Mouse COX17 Protein | +Inquiry |
COX17-449 | Recombinant S.cervisiae S.cervisiae COX17 | +Inquiry |
COX17-448H | Recombinant Human COX17 (S. cerevisiae) | +Inquiry |
COX17-1911M | Recombinant Mouse COX17 Protein, His (Fc)-Avi-tagged | +Inquiry |
COX17-5641C | Recombinant Chicken COX17 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COX17 Products
Required fields are marked with *
My Review for All COX17 Products
Required fields are marked with *