Recombinant Full Length Human COX20 Protein, GST-tagged
Cat.No. : | COX20-2002HF |
Product Overview : | Human COX20 full-length ORF (BAG54176.1, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 118 amino acids |
Description : | This gene encodes a protein that plays a role in the assembly of cytochrome C oxidase, an important component of the respiratory pathway. It contains two transmembrane helices and localizes to the mitochondrial membrane. Mutations in this gene can cause mitochondrial complex IV deficiency, which results in ataxia and muscle hypotonia. There are multiple pseudogenes for this gene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015] |
Molecular Mass : | 39.7 kDa |
AA Sequence : | MAAPPEPGEPEERKSLKLLGFLDVENTPCARHSILYGSLGSVVAGFGHFLFTSRIRRSCDVGVGGFILVTLGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COX20 COX20 Cox2 chaperone homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | COX20 |
Synonyms | FAM36A |
Gene ID | 116228 |
mRNA Refseq | NM_198076.4 |
Protein Refseq | NP_932342.1 |
MIM | 614698 |
UniProt ID | Q5RI15 |
◆ Recombinant Proteins | ||
COX20-2002HF | Recombinant Full Length Human COX20 Protein, GST-tagged | +Inquiry |
COX20-6378HFL | Recombinant Full Length Human COX20 protein, Flag-tagged | +Inquiry |
Cox20-2278M | Recombinant Mouse Cox20 Protein, Myc/DDK-tagged | +Inquiry |
COX20-986R | Recombinant Rhesus monkey COX20 Protein, His-tagged | +Inquiry |
RFL27795MF | Recombinant Full Length Mouse Cytochrome C Oxidase Protein 20 Homolog(Cox20) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COX20 Products
Required fields are marked with *
My Review for All COX20 Products
Required fields are marked with *
0
Inquiry Basket