Recombinant Human COX4I1 Protein (23-169 aa), His-SUMO-tagged

• Cat.No.: COX4I1-419H
• Product Overview: Recombinant Human COX4I1 Protein (23-169 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 23-169 aa
• Description: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 33.2 kDa
• AA Sequence: AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: COX4I1 cytochrome c oxidase subunit IV isoform 1 [ Homo sapiens ]
• Official Symbol: COX4I1
• Synonyms: COX4I1; COX4 1; COX IV-1; COX4; COXIV; COX4-1; FLJ23483; MGC72016
• Gene ID: 1327
• mRNA Refseq: NM_001861
• Protein Refseq: NP_001852
• MIM: 123864
• UniProt ID: P13073