Recombinant Human COX4I1 Protein (23-169 aa), His-SUMO-tagged

Cat.No. : COX4I1-419H
Product Overview : Recombinant Human COX4I1 Protein (23-169 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 23-169 aa
Description : This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 33.2 kDa
AA Sequence : AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name COX4I1 cytochrome c oxidase subunit IV isoform 1 [ Homo sapiens ]
Official Symbol COX4I1
Synonyms COX4I1; COX4 1; COX IV-1; COX4; COXIV; COX4-1; FLJ23483; MGC72016;
Gene ID 1327
mRNA Refseq NM_001861
Protein Refseq NP_001852
MIM 123864
UniProt ID P13073

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COX4I1 Products

Required fields are marked with *

My Review for All COX4I1 Products

Required fields are marked with *

0
cart-icon