Recombinant Human COX4I1 Protein (23-169 aa), His-SUMO-tagged
| Cat.No. : | COX4I1-419H |
| Product Overview : | Recombinant Human COX4I1 Protein (23-169 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 23-169 aa |
| Description : | This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 33.2 kDa |
| AA Sequence : | AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | COX4I1 cytochrome c oxidase subunit IV isoform 1 [ Homo sapiens ] |
| Official Symbol | COX4I1 |
| Synonyms | COX4I1; COX4 1; COX IV-1; COX4; COXIV; COX4-1; FLJ23483; MGC72016; |
| Gene ID | 1327 |
| mRNA Refseq | NM_001861 |
| Protein Refseq | NP_001852 |
| MIM | 123864 |
| UniProt ID | P13073 |
| ◆ Recombinant Proteins | ||
| COX4I1-12731Z | Recombinant Zebrafish COX4I1 | +Inquiry |
| COX4I1-1550R | Recombinant Rat COX4I1 Protein | +Inquiry |
| COX4I1-2003HF | Recombinant Full Length Human COX4I1 Protein, GST-tagged | +Inquiry |
| COX4I1-26361TH | Recombinant Human COX4I1 | +Inquiry |
| COX4I1-2290C | Recombinant Chicken COX4I1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| COX4I1-7334HCL | Recombinant Human COX4I1 293 Cell Lysate | +Inquiry |
| COX4I1-478HKCL | Human COX4I1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COX4I1 Products
Required fields are marked with *
My Review for All COX4I1 Products
Required fields are marked with *
