Recombinant Full Length Human COX6B1 Protein
Cat.No. : | COX6B1-94HF |
Product Overview : | Recombinant full length Human COX6B1 with N-terminal proprietary tag. Predicted MW 35.20kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 87 amino acids |
Description : | Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Mutations in this gene are associated with severe infantile encephalomyopathy. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively. |
Form : | Liquid |
Molecular Mass : | 35.200kDa inclusive of tags |
AA Sequence : | MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | COX6B1 cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous) [ Homo sapiens ] |
Official Symbol | COX6B1 |
Synonyms | COX6B1; cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous); COX6B, cytochrome c oxidase subunit Vib , cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous); cytochrome c oxidase subunit 6B1; COXG |
Gene ID | 1340 |
mRNA Refseq | NM_001863 |
Protein Refseq | NP_001854 |
MIM | 124089 |
UniProt ID | P14854 |
◆ Recombinant Proteins | ||
COX6B1-11496H | Recombinant Human COX6B1, GST-tagged | +Inquiry |
COX6B1-3819M | Recombinant Mouse COX6B1 Protein | +Inquiry |
COX6B1-799Z | Recombinant Zebrafish COX6B1 | +Inquiry |
Cox6b1-464M | Recombinant Mouse Cox6b1 Protein, MYC/DDK-tagged | +Inquiry |
COX6B1-817R | Recombinant Rhesus Macaque COX6B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COX6B1-7329HCL | Recombinant Human COX6B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COX6B1 Products
Required fields are marked with *
My Review for All COX6B1 Products
Required fields are marked with *
0
Inquiry Basket