Recombinant Full Length Human COX6B1 Protein

Cat.No. : COX6B1-94HF
Product Overview : Recombinant full length Human COX6B1 with N-terminal proprietary tag. Predicted MW 35.20kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 87 amino acids
Description : Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Mutations in this gene are associated with severe infantile encephalomyopathy. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively.
Form : Liquid
Molecular Mass : 35.200kDa inclusive of tags
AA Sequence : MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name COX6B1 cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous) [ Homo sapiens ]
Official Symbol COX6B1
Synonyms COX6B1; cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous); COX6B, cytochrome c oxidase subunit Vib , cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous); cytochrome c oxidase subunit 6B1; COXG
Gene ID 1340
mRNA Refseq NM_001863
Protein Refseq NP_001854
MIM 124089
UniProt ID P14854

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COX6B1 Products

Required fields are marked with *

My Review for All COX6B1 Products

Required fields are marked with *

0
cart-icon