Recombinant Full Length Human COX7B Protein, GST-tagged

Cat.No. : COX7B-2016HF
Product Overview : Human COX7B full-length ORF ( AAH18386, 1 a.a. - 80 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 80 amino acids
Description : Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes subunit VIIb, which is highly similar to bovine COX VIIb protein and is found in all tissues. This gene may have several pseudogenes on chromosomes 1, 2, 20 and 22. [provided by RefSeq, Jun 2011]
Molecular Mass : 34.43 kDa
AA Sequence : MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVGRVTPKEWRNQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COX7B cytochrome c oxidase subunit VIIb [ Homo sapiens ]
Official Symbol COX7B
Synonyms COX7B; cytochrome c oxidase subunit VIIb; cytochrome c oxidase subunit 7B, mitochondrial; cytochrome-c oxidase chain VIIb; cytochrome c oxidase polypeptide VIIb
Gene ID 1349
mRNA Refseq NM_001866
Protein Refseq NP_001857
MIM 603792
UniProt ID P24311

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COX7B Products

Required fields are marked with *

My Review for All COX7B Products

Required fields are marked with *

0
cart-icon
0
compare icon