Recombinant Full Length Human CREBZF Protein, GST-tagged

• Cat.No.: CREBZF-2289HF
• Product Overview: Human CREBZF full-length ORF ( ABZ92408.1, 1 a.a. - 272 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 272 amino acids
• Description: CREBZF (CREB/ATF BZIP Transcription Factor) is a Protein Coding gene. Among its related pathways are B Cell Receptor Signaling Pathway (sino) and MAPK-Erk Pathway. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and identical protein binding.
• Molecular Mass: 30 kDa
• AA Sequence: MEEEAIASLPGEETEDMDFLSGLELADLLDPRQPDWHLDPGLSSPGPLSSSGGGSDSGGLWRGDDDDEAAAAEMQRFSDLLQRLLNGIGGCSSSSDSGSAEKRRRKSPGGGGGGGSGNDNNQAATKSPRKAAAAAARLNRLKKKEYVMGLESRVRGLAAENQELRAENRELGKRVQALQEESRYLRAVLANETGLARLLSRLSGVGLRLTTSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCSACARKASSSLKM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CREBZF CREB/ATF bZIP transcription factor [ Homo sapiens ]
• Official Symbol: CREBZF
• Synonyms: CREBZF; CREB/ATF bZIP transcription factor; ZF; Zhangfei; SHP-interacting leucine zipper protein; HCF-binding transcription factor Zhangfei; host cell factor-binding transcription factor Zhangfei; SMILE; FLJ94018
• Gene ID: 58487
• mRNA Refseq: NM_001039618
• Protein Refseq: NP_001034707
• MIM: 606444
• UniProt ID: Q9NS37