Recombinant Human CREBZF Protein, GST-tagged
Cat.No. : | CREBZF-1856H |
Product Overview : | Human CREBZF full-length ORF ( ABZ92408.1, 1 a.a. - 272 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CREBZF (CREB/ATF BZIP Transcription Factor) is a Protein Coding gene. Among its related pathways are B Cell Receptor Signaling Pathway (sino) and MAPK-Erk Pathway. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and identical protein binding. |
Molecular Mass : | 30 kDa |
AA Sequence : | MEEEAIASLPGEETEDMDFLSGLELADLLDPRQPDWHLDPGLSSPGPLSSSGGGSDSGGLWRGDDDDEAAAAEMQRFSDLLQRLLNGIGGCSSSSDSGSAEKRRRKSPGGGGGGGSGNDNNQAATKSPRKAAAAAARLNRLKKKEYVMGLESRVRGLAAENQELRAENRELGKRVQALQEESRYLRAVLANETGLARLLSRLSGVGLRLTTSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCSACARKASSSLKM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CREBZF CREB/ATF bZIP transcription factor [ Homo sapiens ] |
Official Symbol | CREBZF |
Synonyms | CREBZF; CREB/ATF bZIP transcription factor; ZF; Zhangfei; SHP-interacting leucine zipper protein; HCF-binding transcription factor Zhangfei; host cell factor-binding transcription factor Zhangfei; SMILE; FLJ94018; |
Gene ID | 58487 |
mRNA Refseq | NM_001039618 |
Protein Refseq | NP_001034707 |
MIM | 606444 |
UniProt ID | Q9NS37 |
◆ Recombinant Proteins | ||
CREBZF-1024R | Recombinant Rhesus monkey CREBZF Protein, His-tagged | +Inquiry |
CREBZF-2289HF | Recombinant Full Length Human CREBZF Protein, GST-tagged | +Inquiry |
CREBZF-849R | Recombinant Rhesus Macaque CREBZF Protein, His (Fc)-Avi-tagged | +Inquiry |
CREBZF-1856H | Recombinant Human CREBZF Protein, GST-tagged | +Inquiry |
CREBZF-3895M | Recombinant Mouse CREBZF Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CREBZF-199HCL | Recombinant Human CREBZF lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CREBZF Products
Required fields are marked with *
My Review for All CREBZF Products
Required fields are marked with *