Recombinant Human CREBZF Protein, GST-tagged

Cat.No. : CREBZF-1856H
Product Overview : Human CREBZF full-length ORF ( ABZ92408.1, 1 a.a. - 272 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CREBZF (CREB/ATF BZIP Transcription Factor) is a Protein Coding gene. Among its related pathways are B Cell Receptor Signaling Pathway (sino) and MAPK-Erk Pathway. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and identical protein binding.
Molecular Mass : 30 kDa
AA Sequence : MEEEAIASLPGEETEDMDFLSGLELADLLDPRQPDWHLDPGLSSPGPLSSSGGGSDSGGLWRGDDDDEAAAAEMQRFSDLLQRLLNGIGGCSSSSDSGSAEKRRRKSPGGGGGGGSGNDNNQAATKSPRKAAAAAARLNRLKKKEYVMGLESRVRGLAAENQELRAENRELGKRVQALQEESRYLRAVLANETGLARLLSRLSGVGLRLTTSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCSACARKASSSLKM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CREBZF CREB/ATF bZIP transcription factor [ Homo sapiens ]
Official Symbol CREBZF
Synonyms CREBZF; CREB/ATF bZIP transcription factor; ZF; Zhangfei; SHP-interacting leucine zipper protein; HCF-binding transcription factor Zhangfei; host cell factor-binding transcription factor Zhangfei; SMILE; FLJ94018;
Gene ID 58487
mRNA Refseq NM_001039618
Protein Refseq NP_001034707
MIM 606444
UniProt ID Q9NS37

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CREBZF Products

Required fields are marked with *

My Review for All CREBZF Products

Required fields are marked with *

0
cart-icon
0
compare icon