Recombinant Human CREBZF Protein, GST-tagged
| Cat.No. : | CREBZF-1856H |
| Product Overview : | Human CREBZF full-length ORF ( ABZ92408.1, 1 a.a. - 272 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CREBZF (CREB/ATF BZIP Transcription Factor) is a Protein Coding gene. Among its related pathways are B Cell Receptor Signaling Pathway (sino) and MAPK-Erk Pathway. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and identical protein binding. |
| Molecular Mass : | 30 kDa |
| AA Sequence : | MEEEAIASLPGEETEDMDFLSGLELADLLDPRQPDWHLDPGLSSPGPLSSSGGGSDSGGLWRGDDDDEAAAAEMQRFSDLLQRLLNGIGGCSSSSDSGSAEKRRRKSPGGGGGGGSGNDNNQAATKSPRKAAAAAARLNRLKKKEYVMGLESRVRGLAAENQELRAENRELGKRVQALQEESRYLRAVLANETGLARLLSRLSGVGLRLTTSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCSACARKASSSLKM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CREBZF CREB/ATF bZIP transcription factor [ Homo sapiens ] |
| Official Symbol | CREBZF |
| Synonyms | CREBZF; CREB/ATF bZIP transcription factor; ZF; Zhangfei; SHP-interacting leucine zipper protein; HCF-binding transcription factor Zhangfei; host cell factor-binding transcription factor Zhangfei; SMILE; FLJ94018; |
| Gene ID | 58487 |
| mRNA Refseq | NM_001039618 |
| Protein Refseq | NP_001034707 |
| MIM | 606444 |
| UniProt ID | Q9NS37 |
| ◆ Recombinant Proteins | ||
| CREBZF-3895M | Recombinant Mouse CREBZF Protein | +Inquiry |
| CREBZF-3167H | Recombinant Human CREBZF protein, His-tagged | +Inquiry |
| CREBZF-1856H | Recombinant Human CREBZF Protein, GST-tagged | +Inquiry |
| CREBZF-1970M | Recombinant Mouse CREBZF Protein, His (Fc)-Avi-tagged | +Inquiry |
| Crebzf-3837M | Recombinant Mouse Crebzf protein(1-358aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CREBZF-199HCL | Recombinant Human CREBZF lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CREBZF Products
Required fields are marked with *
My Review for All CREBZF Products
Required fields are marked with *
