Recombinant Human CREBZF protein, His-tagged
Cat.No. : | CREBZF-3167H |
Product Overview : | Recombinant Human CREBZF protein(185-301 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | September 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 185-301 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | GLAAENQELRAENRELGKRVQALQEESRYLRAVLANETGLARLLSRLSGVGLRLTTSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCSACARKASSSLKM |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | CREBZF CREB/ATF bZIP transcription factor [ Homo sapiens ] |
Official Symbol | CREBZF |
Synonyms | CREBZF; CREB/ATF bZIP transcription factor; ZF; Zhangfei; SHP-interacting leucine zipper protein; HCF-binding transcription factor Zhangfei; host cell factor-binding transcription factor Zhangfei; SMILE; FLJ94018; |
Gene ID | 58487 |
mRNA Refseq | NM_001039618 |
Protein Refseq | NP_001034707 |
MIM | 606444 |
UniProt ID | Q9NS37 |
◆ Recombinant Proteins | ||
CREBZF-1970M | Recombinant Mouse CREBZF Protein, His (Fc)-Avi-tagged | +Inquiry |
CREBZF-849R | Recombinant Rhesus Macaque CREBZF Protein, His (Fc)-Avi-tagged | +Inquiry |
CREBZF-1856H | Recombinant Human CREBZF Protein, GST-tagged | +Inquiry |
CREBZF-3167H | Recombinant Human CREBZF protein, His-tagged | +Inquiry |
CREBZF-1024R | Recombinant Rhesus monkey CREBZF Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CREBZF-199HCL | Recombinant Human CREBZF lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CREBZF Products
Required fields are marked with *
My Review for All CREBZF Products
Required fields are marked with *