Recombinant Full Length Human CRIP1 Protein

• Cat.No.: CRIP1-92HF
• Product Overview: Recombinant full length Human CRIP1 with N terminal proprietary tag; Predicted MWt 34.58 kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 77 amino acids
• Description: Cysteine-rich intestinal protein (CRIP) belongs to the LIM/double zinc finger protein family, members of which include cysteine- and glycine-rich protein-1 (CSRP1; MIM 123876), rhombotin-1 (RBTN1; MIM 186921), rhombotin-2 (RBTN2; MIM 180385), and rhombotin-3 (RBTN3; MIM 180386).
• Form: Liquid
• Molecular Mass: 34.580kDa inclusive of tags
• AA Sequence: MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: CRIP1 cysteine-rich protein 1 (intestinal) [ Homo sapiens ]
• Official Symbol: CRIP1
• Synonyms: CRIP1; cysteine-rich protein 1 (intestinal); cysteine-rich protein 1; CRIP
• Gene ID: 1396
• mRNA Refseq: NM_001311
• Protein Refseq: NP_001302
• MIM: 123875
• UniProt ID: P50238