Recombinant Full Length Human CRIP1 Protein
Cat.No. : | CRIP1-92HF |
Product Overview : | Recombinant full length Human CRIP1 with N terminal proprietary tag; Predicted MWt 34.58 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 77 amino acids |
Description : | Cysteine-rich intestinal protein (CRIP) belongs to the LIM/double zinc finger protein family, members of which include cysteine- and glycine-rich protein-1 (CSRP1; MIM 123876), rhombotin-1 (RBTN1; MIM 186921), rhombotin-2 (RBTN2; MIM 180385), and rhombotin-3 (RBTN3; MIM 180386). |
Form : | Liquid |
Molecular Mass : | 34.580kDa inclusive of tags |
AA Sequence : | MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CRIP1 cysteine-rich protein 1 (intestinal) [ Homo sapiens ] |
Official Symbol | CRIP1 |
Synonyms | CRIP1; cysteine-rich protein 1 (intestinal); cysteine-rich protein 1; CRIP |
Gene ID | 1396 |
mRNA Refseq | NM_001311 |
Protein Refseq | NP_001302 |
MIM | 123875 |
UniProt ID | P50238 |
◆ Recombinant Proteins | ||
CRIP1-11575H | Recombinant Human CRIP1, GST-tagged | +Inquiry |
CRIP1-189H | Recombinant Human CRIP1 | +Inquiry |
CRIP1-5451C | Recombinant Chicken CRIP1 | +Inquiry |
CRIP1-1810H | Recombinant Human CRIP1 Protein (Pro2-Lys77), N-GST tagged | +Inquiry |
CRIP1-1256R | Recombinant Rat CRIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRIP1-200HCL | Recombinant Human CRIP1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRIP1 Products
Required fields are marked with *
My Review for All CRIP1 Products
Required fields are marked with *
0
Inquiry Basket