Recombinant Full Length Human CRIP3 Protein, GST-tagged

• Cat.No.: CRIP3-2057HF
• Product Overview: Human CRIP3 full-length ORF ( AAI48847.1, 1 a.a. - 204 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 204 amino acids
• Description: CRIP3 (Cysteine Rich Protein 3) is a Protein Coding gene. An important paralog of this gene is CRIP2.
• Molecular Mass: 49.39 kDa
• AA Sequence: MSWTCPRCQQPVFFAEKVSSLGKNWHRFCLKCERCHSILSPGGHAEHNGRPYCHKPCYGALFGPRGVNIGGVGSYLYNPPTPSPGCTTPLSPSSFSPPRPRTGLPQGKKSPPHMKTFTGETSLCPGCGEPVYFAEKVMSLGRNWHRPCLRCQRCHKTLTAGSHAEHDGVPYCHVPCYGYLFGPKGVNIGDVGCYIYDPVKIKFK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CRIP3 cysteine-rich protein 3 [ Homo sapiens ]
• Official Symbol: CRIP3
• Synonyms: CRIP3; cysteine-rich protein 3; bA480N24.2; TLP; TLP A; CRP-3; h6LIMo; thymus LIM protein TLP-A; chromosome 6 LIM domain only protein; TLP-A
• Gene ID: 401262
• mRNA Refseq: NM_206922
• Protein Refseq: NP_996805
• UniProt ID: Q6Q6R5