Recombinant Full Length Human CSAG3 Protein, GST-tagged

Cat.No. : CSAG3-2149HF
Product Overview : Human CSAG3 full-length ORF ( AAI60156.1, 1 a.a. - 48 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 48 amino acids
Description : CSAG3 (CSAG Family Member 3) is a Protein Coding gene. Diseases associated with CSAG3 include Chondrosarcoma. An important paralog of this gene is CSAG2.
Molecular Mass : 5.3 kDa
AA Sequence : MSRKPRASSPLSNNHPPTPKRRGSGRFPRQPGREKGPIKEVPGTKGSP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CSAG3 CSAG family member 3 [ Homo sapiens (human) ]
Official Symbol CSAG3
Synonyms CSAG3; CSAG family member 3; CSAG Family Member 3; Taxol-Resistant-Associated Gene 3 Protein; Cancer/Testis Antigen 24.2; CSAG Family, Member 3A; CT24.2; CSAG3A; Chondrosarcoma-Associated Gene 2/3 Protein; Taxol Resistance Associated Gene 3; CSAG Family, Member 3; CSAG2 CSAG3; TRAG-3; TRAG3; chondrosarcoma-associated gene 2/3 protein; CSAG family, member 3A; cancer/testis antigen 24.2; taxol resistance associated gene 3; taxol-resistant-associated gene 3 protein
Gene ID 389903
mRNA Refseq NM_001129826
Protein Refseq NP_001123298
UniProt ID Q9Y5P2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSAG3 Products

Required fields are marked with *

My Review for All CSAG3 Products

Required fields are marked with *

0
cart-icon
0
compare icon