Recombinant Full Length Human CSAG3 Protein, GST-tagged

• Cat.No.: CSAG3-2149HF
• Product Overview: Human CSAG3 full-length ORF ( AAI60156.1, 1 a.a. - 48 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 48 amino acids
• Description: CSAG3 (CSAG Family Member 3) is a Protein Coding gene. Diseases associated with CSAG3 include Chondrosarcoma. An important paralog of this gene is CSAG2.
• Molecular Mass: 5.3 kDa
• AA Sequence: MSRKPRASSPLSNNHPPTPKRRGSGRFPRQPGREKGPIKEVPGTKGSP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CSAG3 CSAG family member 3 [ Homo sapiens (human) ]
• Official Symbol: CSAG3
• Synonyms: CSAG3; CSAG family member 3; CSAG Family Member 3; Taxol-Resistant-Associated Gene 3 Protein; Cancer/Testis Antigen 24.2; CSAG Family, Member 3A; CT24.2; CSAG3A; Chondrosarcoma-Associated Gene 2/3 Protein; Taxol Resistance Associated Gene 3; CSAG Family, Member 3; CSAG2 CSAG3; TRAG-3; TRAG3; chondrosarcoma-associated gene 2/3 protein; CSAG family, member 3A; cancer/testis antigen 24.2; taxol resistance associated gene 3; taxol-resistant-associated gene 3 protein
• Gene ID: 389903
• mRNA Refseq: NM_001129826
• Protein Refseq: NP_001123298
• UniProt ID: Q9Y5P2