Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Full Length Human CSAG3 Protein, GST-tagged

Cat.No. : CSAG3-2149HF
Product Overview : Human CSAG3 full-length ORF ( AAI60156.1, 1 a.a. - 48 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
Description : CSAG3 (CSAG Family Member 3) is a Protein Coding gene. Diseases associated with CSAG3 include Chondrosarcoma. An important paralog of this gene is CSAG2.
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 5.3 kDa
Protein Length : 48 amino acids
AA Sequence : MSRKPRASSPLSNNHPPTPKRRGSGRFPRQPGREKGPIKEVPGTKGSP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : CSAG3 CSAG family member 3 [ Homo sapiens (human) ]
Official Symbol : CSAG3
Synonyms : CSAG3; CSAG family member 3; CSAG Family Member 3; Taxol-Resistant-Associated Gene 3 Protein; Cancer/Testis Antigen 24.2; CSAG Family, Member 3A; CT24.2; CSAG3A; Chondrosarcoma-Associated Gene 2/3 Protein; Taxol Resistance Associated Gene 3; CSAG Family, Member 3; CSAG2 CSAG3; TRAG-3; TRAG3; chondrosarcoma-associated gene 2/3 protein; CSAG family, member 3A; cancer/testis antigen 24.2; taxol resistance associated gene 3; taxol-resistant-associated gene 3 protein
Gene ID : 389903
mRNA Refseq : NM_001129826
Protein Refseq : NP_001123298
UniProt ID : Q9Y5P2

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends