Recombinant Human CSAG3 Protein, GST-tagged
Cat.No. : | CSAG3-1955H |
Product Overview : | Human CSAG3 full-length ORF ( AAI60156.1, 1 a.a. - 48 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
Description : | CSAG3 (CSAG Family Member 3) is a Protein Coding gene. Diseases associated with CSAG3 include Chondrosarcoma. An important paralog of this gene is CSAG2. |
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Molecular Mass : | 5.3 kDa |
AA Sequence : | MSRKPRASSPLSNNHPPTPKRRGSGRFPRQPGREKGPIKEVPGTKGSP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name : | CSAG3 CSAG family member 3 [ Homo sapiens (human) ] |
Official Symbol : | CSAG3 |
Synonyms : | CSAG3; CSAG family member 3; CSAG Family Member 3; Taxol-Resistant-Associated Gene 3 Protein; Cancer/Testis Antigen 24.2; CSAG Family, Member 3A; CT24.2; CSAG3A; Chondrosarcoma-Associated Gene 2/3 Protein; Taxol Resistance Associated Gene 3; CSAG Family, Member 3; CSAG2 CSAG3; TRAG-3; TRAG3; chondrosarcoma-associated gene 2/3 protein; CSAG family, member 3A; cancer/testis antigen 24.2; taxol resistance associated gene 3; taxol-resistant-associated gene 3 protein |
Gene ID : | 389903 |
mRNA Refseq : | NM_001129826 |
Protein Refseq : | NP_001123298 |
UniProt ID : | Q9Y5P2 |
Products Types
◆ Recombinant Protein | ||
CSAG3-3340H | Recombinant Human CSAG3 Protein, His-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket