Recombinant Full Length Human CSRP2 Protein, GST-tagged

Cat.No. : CSRP2-2219HF
Product Overview : Human CSRP2 full-length ORF ( AAH00992, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 193 amino acids
Description : CSRP2 is a member of the CSRP family of genes, encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. CRP2 contains two copies of the cysteine-rich amino acid sequence motif (LIM) with putative zinc-binding activity, and may be involved in regulating ordered cell growth. Other genes in the family include CSRP1 and CSRP3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
Molecular Mass : 46.97 kDa
AA Sequence : MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CSRP2 cysteine and glycine-rich protein 2 [ Homo sapiens ]
Official Symbol CSRP2
Synonyms CSRP2; cysteine and glycine-rich protein 2; CRP2; LMO5; SmLIM; LMO-5; cysteine-rich protein 2; LIM domain only protein 5; smooth muscle cell LIM protein; LIM domain only 5, smooth muscle
Gene ID 1466
mRNA Refseq NM_001321
Protein Refseq NP_001312
MIM 601871
UniProt ID Q16527

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSRP2 Products

Required fields are marked with *

My Review for All CSRP2 Products

Required fields are marked with *

0
cart-icon