Recombinant Full Length Human CSRP2 Protein, GST-tagged
Cat.No. : | CSRP2-2219HF |
Product Overview : | Human CSRP2 full-length ORF ( AAH00992, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 193 amino acids |
Description : | CSRP2 is a member of the CSRP family of genes, encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. CRP2 contains two copies of the cysteine-rich amino acid sequence motif (LIM) with putative zinc-binding activity, and may be involved in regulating ordered cell growth. Other genes in the family include CSRP1 and CSRP3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Molecular Mass : | 46.97 kDa |
AA Sequence : | MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CSRP2 cysteine and glycine-rich protein 2 [ Homo sapiens ] |
Official Symbol | CSRP2 |
Synonyms | CSRP2; cysteine and glycine-rich protein 2; CRP2; LMO5; SmLIM; LMO-5; cysteine-rich protein 2; LIM domain only protein 5; smooth muscle cell LIM protein; LIM domain only 5, smooth muscle |
Gene ID | 1466 |
mRNA Refseq | NM_001321 |
Protein Refseq | NP_001312 |
MIM | 601871 |
UniProt ID | Q16527 |
◆ Recombinant Proteins | ||
CSRP2-840HFL | Recombinant Full Length Human CSRP2 Protein, C-Flag-tagged | +Inquiry |
CSRP2-2019H | Recombinant Human CSRP2 Protein, GST-tagged | +Inquiry |
CSRP2-5233H | Recombinant Human CSRP2 protein, His-tagged | +Inquiry |
CSRP2-675H | Recombinant Human CSRP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Csrp2-2344M | Recombinant Mouse Csrp2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSRP2-7232HCL | Recombinant Human CSRP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSRP2 Products
Required fields are marked with *
My Review for All CSRP2 Products
Required fields are marked with *