Recombinant Full Length Human CSTF3 Protein, GST-tagged
| Cat.No. : | CSTF3-2253HF |
| Product Overview : | Human CSTF3 full-length ORF ( AAH09792, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 103 amino acids |
| Description : | The protein encoded by this gene is one of three (including CSTF1 and CSTF2) cleavage stimulation factors that combine to form the cleavage stimulation factor complex (CSTF). This complex is involved in the polyadenylation and 3' end cleavage of pre-mRNAs. The encoded protein functions as a homodimer and interacts directly with both CSTF1 and CSTF2 in the CSTF complex. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 37.07 kDa |
| AA Sequence : | MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEVTILFYFFLYQYCSIHCSDRKQVRNIAN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CSTF3 cleavage stimulation factor, 3 pre-RNA, subunit 3, 77kDa [ Homo sapiens ] |
| Official Symbol | CSTF3 |
| Synonyms | CSTF3; cleavage stimulation factor, 3 pre-RNA, subunit 3, 77kDa; cleavage stimulation factor, 3 pre RNA, subunit 3, 77kD; cleavage stimulation factor subunit 3; CstF 77; CF-1 77 kDa subunit; CSTF 77 kDa subunit; cleavage stimulation factor 77 kDa subunit; cleavage stimulation factor subunit 3, isoform 1; CSTF-77; MGC43001; MGC75122; MGC117398 |
| Gene ID | 1479 |
| mRNA Refseq | NM_001033505 |
| Protein Refseq | NP_001028677 |
| MIM | 600367 |
| UniProt ID | Q12996 |
| ◆ Recombinant Proteins | ||
| CSTF3-2044H | Recombinant Human CSTF3 Protein, GST-tagged | +Inquiry |
| CSTF3-11652H | Recombinant Human CSTF3, GST-tagged | +Inquiry |
| Cstf3-2350M | Recombinant Mouse Cstf3 Protein, Myc/DDK-tagged | +Inquiry |
| CSTF3-2253HF | Recombinant Full Length Human CSTF3 Protein, GST-tagged | +Inquiry |
| CSTF3-1072R | Recombinant Rhesus monkey CSTF3 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CSTF3-7222HCL | Recombinant Human CSTF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSTF3 Products
Required fields are marked with *
My Review for All CSTF3 Products
Required fields are marked with *
