Recombinant Full Length Human CTNNA1 Protein, GST-tagged

Cat.No. : CTNNA1-2294HF
Product Overview : Human CTNNA1 full-length ORF ( AAH31262.1, 1 a.a. - 536 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 536 amino acids
Description : This gene encodes a member of the catenin family of proteins that play an important role in cell adhesion process by connecting cadherins located on the plasma membrane to the actin filaments inside the cell. The encoded mechanosensing protein contains three vinculin homology domains and undergoes conformational changes in response to cytoskeletal tension, resulting in the reconfiguration of cadherin-actin filament connections. Certain mutations in this gene cause butterfly-shaped pigment dystrophy. [provided by RefSeq, May 2016]
Molecular Mass : 85.9 kDa
AA Sequence : MTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYAQVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLAQENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDRTAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSDPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVASTKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEFKAMDSI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CTNNA1 catenin (cadherin-associated protein), alpha 1, 102kDa [ Homo sapiens ]
Official Symbol CTNNA1
Synonyms CTNNA1; catenin (cadherin-associated protein), alpha 1, 102kDa; catenin (cadherin associated protein), alpha 1 (102kD); catenin alpha-1; CAP102; alpha-catenin; alphaE-catenin; alpha E-catenin; alpha-E-catenin; renal carcinoma antigen NY-REN-13; cadherin-associated protein,102kDa; FLJ36832; FLJ52416
Gene ID 1495
mRNA Refseq NM_001903
Protein Refseq NP_001894
MIM 116805
UniProt ID P35221

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTNNA1 Products

Required fields are marked with *

My Review for All CTNNA1 Products

Required fields are marked with *

0
cart-icon
0
compare icon