Recombinant Human CTNNA1 Protein, GST-tagged
Cat.No. : | CTNNA1-2076H |
Product Overview : | Human CTNNA1 full-length ORF ( AAH31262.1, 1 a.a. - 536 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the catenin family of proteins that play an important role in cell adhesion process by connecting cadherins located on the plasma membrane to the actin filaments inside the cell. The encoded mechanosensing protein contains three vinculin homology domains and undergoes conformational changes in response to cytoskeletal tension, resulting in the reconfiguration of cadherin-actin filament connections. Certain mutations in this gene cause butterfly-shaped pigment dystrophy. [provided by RefSeq, May 2016] |
Molecular Mass : | 85.9 kDa |
AA Sequence : | MTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYAQVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLAQENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDRTAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSDPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVASTKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEFKAMDSI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CTNNA1 catenin (cadherin-associated protein), alpha 1, 102kDa [ Homo sapiens ] |
Official Symbol | CTNNA1 |
Synonyms | CTNNA1; catenin (cadherin-associated protein), alpha 1, 102kDa; catenin (cadherin associated protein), alpha 1 (102kD); catenin alpha-1; CAP102; alpha-catenin; alphaE-catenin; alpha E-catenin; alpha-E-catenin; renal carcinoma antigen NY-REN-13; cadherin-associated protein,102kDa; FLJ36832; FLJ52416; |
Gene ID | 1495 |
mRNA Refseq | NM_001903 |
Protein Refseq | NP_001894 |
MIM | 116805 |
UniProt ID | P35221 |
◆ Recombinant Proteins | ||
CTNNA1-399H | Recombinant Human CTNNA1 Protein, His-tagged | +Inquiry |
CTNNA1-2055M | Recombinant Mouse CTNNA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CTNNA1-2076H | Recombinant Human CTNNA1 Protein, GST-tagged | +Inquiry |
CTNNA1-903R | Recombinant Rhesus Macaque CTNNA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CTNNA1-126H | Recombinant Human CTNNA1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTNNA1-7203HCL | Recombinant Human CTNNA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTNNA1 Products
Required fields are marked with *
My Review for All CTNNA1 Products
Required fields are marked with *