Recombinant Full Length Human CTNS Protein, GST-tagged
| Cat.No. : | CTNS-2320HF | 
| Product Overview : | Human CTNS full-length ORF ( AAH32850.1, 1 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 400 amino acids | 
| Description : | This gene encodes a seven-transmembrane domain protein that functions to transport cystine out of lysosomes. Its activity is driven by the H+ electrochemical gradient of the lysosomal membrane. Mutations in this gene cause cystinosis, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2009] | 
| Molecular Mass : | 71.5 kDa | 
| AA Sequence : | MIRNWLTIFILFPLKLVEKCESSVSLTVPPVVKLENGSSTNVSLTLRPPLNATLVITFEITFRSKNITILELPDEVVVPPGVTNSSFQVTSQNVGQLTVYLHGNHSNQTGPRIRFLVIRSSAISIINQVIGWIYFVAWSISFYPQVIMNWRRKSVIGLSFDFVALNLTGFVAYSVFNIGLLWVPYIKEQFLLKYPNGVNPVNSNDVFFSLHAVVLTLIIIVQCCLYERGGQRVSWPAIGFLVLAWLFAFVTMIVAAVGVITWLQFLFCFSYIKLAVTLVKYFPQAYMNFYYKSTEGWSIGNVLLDFTGGSFSLLQMFLQSYNNDQWTLIFGDPTKFGLGVFSIVFDVVFFIQHFCLYRKRPGLQAARTGSGSRLRQDWAPSLQPKALPQTTSVSASSLKG | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CTNS cystinosin, lysosomal cystine transporter [ Homo sapiens ] | 
| Official Symbol | CTNS | 
| Synonyms | CTNS; cystinosin, lysosomal cystine transporter; cystinosis, nephropathic; cystinosin; CTNS LSB; PQLC4; CTNS-LSB; | 
| Gene ID | 1497 | 
| mRNA Refseq | NM_001031681 | 
| Protein Refseq | NP_001026851 | 
| MIM | 606272 | 
| UniProt ID | O60931 | 
| ◆ Recombinant Proteins | ||
| CTNS-4113H | Recombinant Human CTNS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| CTNS-2754Z | Recombinant Zebrafish CTNS | +Inquiry | 
| CTNS-2059M | Recombinant Mouse CTNS Protein, His (Fc)-Avi-tagged | +Inquiry | 
| Ctns-2363M | Recombinant Mouse Ctns Protein, Myc/DDK-tagged | +Inquiry | 
| CTNS-2091H | Recombinant Human CTNS Protein, MYC/DDK-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CTNS-7199HCL | Recombinant Human CTNS 293 Cell Lysate | +Inquiry | 
| CTNS-7198HCL | Recombinant Human CTNS 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTNS Products
Required fields are marked with *
My Review for All CTNS Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            