Recombinant Full Length Human CTXN1 Protein, GST-tagged

• Cat.No.: CTXN1-2369HF
• Product Overview: Human CTXN1 full-length ORF (1 a.a. - 82 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 82 amino acids
• Description: CTXN1 (Cortexin 1) is a Protein Coding gene. An important paralog of this gene is CTXN3.
• Molecular Mass: 35.42 kDa
• AA Sequence: MSATWTLSPEPLPPSTGPPVGAGLDAEQRTVFAFVLCLLVVLVLLMVRCVRILLDPYSRMPASSWTDHKEALERGQFDYALV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CTXN1 cortexin 1 [ Homo sapiens ]
• Official Symbol: CTXN1
• Synonyms: CTXN
• Gene ID: 404217
• mRNA Refseq: NM_206833.3
• Protein Refseq: NP_996664.1
• MIM: 600135
• UniProt ID: P60606