Recombinant Full Length Human CUEDC2 Protein, GST-tagged

• Cat.No.: CUEDC2-2371HF
• Product Overview: Human CUEDC2 full-length ORF ( NP_076945.1, 1 a.a. - 226 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 226 amino acids
• Description: CUEDC2 (CUE Domain Containing 2) is a Protein Coding gene. Among its related pathways are DNA Damage and Toll-like Receptor Signaling Pathway.
• Molecular Mass: 51.1 kDa
• AA Sequence: MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CUEDC2 CUE domain containing 2 [ Homo sapiens ]
• Official Symbol: CUEDC2
• Synonyms: C10orf66; bA18I14.5
• Gene ID: 79004
• mRNA Refseq: NM_024040.2
• Protein Refseq: NP_076945.2
• MIM: 614142
• UniProt ID: Q9H467