Recombinant Full Length Human CUEDC2 Protein, GST-tagged

Cat.No. : CUEDC2-2371HF
Product Overview : Human CUEDC2 full-length ORF ( NP_076945.1, 1 a.a. - 226 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 226 amino acids
Description : CUEDC2 (CUE Domain Containing 2) is a Protein Coding gene. Among its related pathways are DNA Damage and Toll-like Receptor Signaling Pathway.
Molecular Mass : 51.1 kDa
AA Sequence : MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CUEDC2 CUE domain containing 2 [ Homo sapiens ]
Official Symbol CUEDC2
Synonyms C10orf66; bA18I14.5
Gene ID 79004
mRNA Refseq NM_024040.2
Protein Refseq NP_076945.2
MIM 614142
UniProt ID Q9H467

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CUEDC2 Products

Required fields are marked with *

My Review for All CUEDC2 Products

Required fields are marked with *

0
cart-icon
0
compare icon