Recombinant Full Length Human CXCL14 Protein, GST-tagged
| Cat.No. : | CXCL14-2285HF |
| Product Overview : | Human CXCL14 full-length ORF ( AAH03513, 1 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 111 amino acids |
| Description : | This antimicrobial gene belongs to the cytokine gene family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation. [provided by RefSeq, Sep 2014] |
| Molecular Mass : | 37.95 kDa |
| AA Sequence : | MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CXCL14 chemokine (C-X-C motif) ligand 14 [ Homo sapiens ] |
| Official Symbol | CXCL14 |
| Synonyms | CXCL14; chemokine (C-X-C motif) ligand 14; SCYB14, small inducible cytokine subfamily B (Cys X Cys), member 14 (BRAK); C-X-C motif chemokine 14; BMAC; bolekine; BRAK; breast and kidney; Kec; KS1; MIP 2g; NJAC; MIP-2 gamma; chemokine BRAK; tumor-suppressing chemokine; small-inducible cytokine B14; CXC chemokine in breast and kidney; small inducible cytokine subfamily B (Cys-X-Cys), member 14 (BRAK); KEC; MIP2G; MIP-2g; SCYB14; MGC10687 |
| Gene ID | 9547 |
| mRNA Refseq | NM_004887 |
| Protein Refseq | NP_004878 |
| MIM | 604186 |
| UniProt ID | O95715 |
| ◆ Recombinant Proteins | ||
| CXCL14-23H | Recombinant Human CXCL14 Protein, Biotin-tagged | +Inquiry |
| Cxcl14-7163M | Recombinant Mouse Cxcl14 protein, His & T7-tagged | +Inquiry |
| CXCL14-6277C | Recombinant Chicken CXCL14 | +Inquiry |
| CXCL14-25H | Recombinant Human CXCL14, His-tagged | +Inquiry |
| CXCL14-101H | Human CXCL14, Biotin-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCL14-7169HCL | Recombinant Human CXCL14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL14 Products
Required fields are marked with *
My Review for All CXCL14 Products
Required fields are marked with *
