Recombinant Full Length Human CXCL14 Protein, GST-tagged

Cat.No. : CXCL14-2285HF
Product Overview : Human CXCL14 full-length ORF ( AAH03513, 1 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 111 amino acids
Description : This antimicrobial gene belongs to the cytokine gene family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation. [provided by RefSeq, Sep 2014]
Molecular Mass : 37.95 kDa
AA Sequence : MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CXCL14 chemokine (C-X-C motif) ligand 14 [ Homo sapiens ]
Official Symbol CXCL14
Synonyms CXCL14; chemokine (C-X-C motif) ligand 14; SCYB14, small inducible cytokine subfamily B (Cys X Cys), member 14 (BRAK); C-X-C motif chemokine 14; BMAC; bolekine; BRAK; breast and kidney; Kec; KS1; MIP 2g; NJAC; MIP-2 gamma; chemokine BRAK; tumor-suppressing chemokine; small-inducible cytokine B14; CXC chemokine in breast and kidney; small inducible cytokine subfamily B (Cys-X-Cys), member 14 (BRAK); KEC; MIP2G; MIP-2g; SCYB14; MGC10687
Gene ID 9547
mRNA Refseq NM_004887
Protein Refseq NP_004878
MIM 604186
UniProt ID O95715

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL14 Products

Required fields are marked with *

My Review for All CXCL14 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon