Recombinant Full Length Human CXCL6 Protein, GST-tagged
| Cat.No. : | CXCL6-2299HF |
| Product Overview : | Human CXCL6 full-length ORF ( AAH13744, 1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 114 amino acids |
| Description : | CXCL6 (C-X-C Motif Chemokine Ligand 6) is a Protein Coding gene. Diseases associated with CXCL6 include Mastitis and Rheumatoid Arthritis. Among its related pathways arePeptide ligand-binding receptors and Chemokine Superfamily Pathway: Human/Mouse Ligand-Receptor Interactions. GO annotations related to this gene include heparin binding andCXCR chemokine receptor binding. An important paralog of this gene is CXCL5. |
| Molecular Mass : | 38.28 kDa |
| AA Sequence : | MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CXCL6 chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2) [ Homo sapiens ] |
| Official Symbol | CXCL6 |
| Synonyms | CXCL6; chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2); SCYB6, small inducible cytokine subfamily B (Cys X Cys), member 6 (granulocyte chemotactic protein 2); C-X-C motif chemokine 6; CKA 3; GCP 2; chemokine alpha 3; small-inducible cytokine B6; granulocyte chemotactic protein 2; Small inducible cytokine subfamily B (Cys-X-Cys), member b; small inducible cytokine subfamily B (Cys-X-Cys), member 6 (granulocyte chemotactic protein 2); GCP2; CKA-3; GCP-2; SCYB6; |
| Gene ID | 6372 |
| mRNA Refseq | NM_002993 |
| Protein Refseq | NP_002984 |
| MIM | 138965 |
| UniProt ID | P80162 |
| ◆ Recombinant Proteins | ||
| CXCL6-123H | Active Recombinant Human CXCL6, MIgG2a Fc-tagged | +Inquiry |
| CXCL6-171H | Active Recombinant Human CXCL6 protein | +Inquiry |
| CXCL6-170H | Recombinant Human CXCL6(Gly38-Asn114) Protein, C-6*His-tagged | +Inquiry |
| CXCL6-2299HF | Recombinant Full Length Human CXCL6 Protein, GST-tagged | +Inquiry |
| CXCL6-6532H | Recombinant Human CXCL6 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCL6-7166HCL | Recombinant Human CXCL6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL6 Products
Required fields are marked with *
My Review for All CXCL6 Products
Required fields are marked with *
