Recombinant Full Length Human CXCR4 Protein
| Cat.No. : | CXCR4-6894HF |
| Product Overview : | Recombinant Human full-length CXCR4 was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 352 amino acids |
| Description : | This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
| Form : | Liquid |
| Molecular Mass : | 39.7 kDa |
| AA Sequence : | MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDK YRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKL LAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISK LSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS |
| Applications : | Antibody Production; Functional Study; Compound Screening |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH 8.0 containing 2% glycerol. |
| Gene Name | CXCR4 chemokine (C-X-C motif) receptor 4 [ Homo sapiens ] |
| Official Symbol | CXCR4 |
| Synonyms | CXCR4; chemokine (C-X-C motif) receptor 4; chemokine (C X C motif), receptor 4 (fusin); C-X-C chemokine receptor type 4; CD184; D2S201E; fusin; HM89; HSY3RR; LESTR; NPY3R; NPYR; NPYY3R; CXC-R4; CXCR-4; CD184 antigen; SDF-1 receptor; neuropeptide Y receptor Y3; seven transmembrane helix receptor; stromal cell-derived factor 1 receptor; lipopolysaccharide-associated protein 3; seven-transmembrane-segment receptor, spleen; leukocyte-derived seven transmembrane domain receptor; leukocyte-derived seven-transmembrane-domain receptor; FB22; LAP3; LCR1; WHIM; NPYRL |
| Gene ID | 7852 |
| mRNA Refseq | NM_001008540 |
| Protein Refseq | NP_001008540 |
| MIM | 162643 |
| UniProt ID | P61073 |
| ◆ Recombinant Proteins | ||
| CXCR4-4110M | Recombinant Mouse CXCR4 Protein | +Inquiry |
| CXCR4-2101M | Recombinant Mouse CXCR4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL30672CF | Recombinant Full Length Dog C-X-C Chemokine Receptor Type 4(Cxcr4) Protein, His-Tagged | +Inquiry |
| CXCR4-3954H | Active Recombinant Human CXCR4 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
| CXCR4-503H | Recombinant Human CXCR4, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCR4-7161HCL | Recombinant Human CXCR4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCR4 Products
Required fields are marked with *
My Review for All CXCR4 Products
Required fields are marked with *



