Recombinant Full Length Human CXCR6 Protein

Cat.No. : CXCR6-2326HF
Product Overview : Human CXCR6 full-length ORF (NP_006555.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 342 amino acids
Description : CXCR6 (C-X-C Motif Chemokine Receptor 6) is a Protein Coding gene. Diseases associated with CXCR6 include Xanthogranulomatous Cholecystitis. Among its related pathways are Peptide ligand-binding receptors and Chemokine Superfamily Pathway: Human/Mouse Ligand-Receptor Interactions. GO annotations related to this gene include G-protein coupled receptor activity and C-X-C chemokine receptor activity. An important paralog of this gene is CCR6.
Form : Liquid
Molecular Mass : 39.3 kDa
AA Sequence : MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYHKLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLILTCITVDRFIVVVKATKAYNQQAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLICGYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVFLLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFWKLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name CXCR6 chemokine (C-X-C motif) receptor 6 [ Homo sapiens ]
Official Symbol CXCR6
Synonyms CXCR6; chemokine (C-X-C motif) receptor 6; C-X-C chemokine receptor type 6; BONZO; CD186; STRL33; TYMSTR; CDw186; CXC-R6; CXCR-6; G protein-coupled receptor; G-protein coupled receptor bonzo; G-protein coupled receptor STRL33;
Gene ID 10663
mRNA Refseq NM_006564
Protein Refseq NP_006555
MIM 605163
UniProt ID O00574

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCR6 Products

Required fields are marked with *

My Review for All CXCR6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon