Recombinant Human CXCR6 Protein, GST-tagged
| Cat.No. : | CXCR6-2184H |
| Product Overview : | Human CXCR6 full-length ORF ( AAH33584.1, 1 a.a. - 342 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CXCR6 (C-X-C Motif Chemokine Receptor 6) is a Protein Coding gene. Diseases associated with CXCR6 include Xanthogranulomatous Cholecystitis. Among its related pathways are Peptide ligand-binding receptors and Chemokine Superfamily Pathway: Human/Mouse Ligand-Receptor Interactions. GO annotations related to this gene include G-protein coupled receptor activity and C-X-C chemokine receptor activity. An important paralog of this gene is CCR6. |
| Molecular Mass : | 63.36 kDa |
| AA Sequence : | MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYHKLQSLTDVFLVNLPPADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLILTCITVDRFIVVVKATKAYNQQAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLICGYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLPHAGGFQKHRSLKIIFLVMAVFLLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFWKLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CXCR6 chemokine (C-X-C motif) receptor 6 [ Homo sapiens ] |
| Official Symbol | CXCR6 |
| Synonyms | CXCR6; chemokine (C-X-C motif) receptor 6; C-X-C chemokine receptor type 6; BONZO; CD186; STRL33; TYMSTR; CDw186; CXC-R6; CXCR-6; G protein-coupled receptor; G-protein coupled receptor bonzo; G-protein coupled receptor STRL33; |
| Gene ID | 10663 |
| mRNA Refseq | NM_006564 |
| Protein Refseq | NP_006555 |
| MIM | 605163 |
| UniProt ID | O00574 |
| ◆ Recombinant Proteins | ||
| CXCR6-2183H | Recombinant Human CXCR6 Protein | +Inquiry |
| CXCR6-2328HF | Recombinant Full Length Human CXCR6 Protein, GST-tagged | +Inquiry |
| CXCR6-4112M | Recombinant Mouse CXCR6 Protein | +Inquiry |
| CXCR6-0989H | Active Recombinant Human CXCR6 Full Length Transmembrane protein(VLPs) | +Inquiry |
| RFL8430CF | Recombinant Full Length Chlorocebus Aethiops C-X-C Chemokine Receptor Type 6(Cxcr6) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCR6-7160HCL | Recombinant Human CXCR6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCR6 Products
Required fields are marked with *
My Review for All CXCR6 Products
Required fields are marked with *
