Recombinant Full Length Human CXorf38 Protein, GST-tagged

Cat.No. : CXorf38-2342HF
Product Overview : Human CXorf38 full-length ORF ( NP_659407.1, 1 a.a. - 319 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 319 amino acids
Description : CXorf38 (Chromosome X Open Reading Frame 38) is a Protein Coding gene.
Molecular Mass : 63.1 kDa
AA Sequence : MVLSELAARLNCAEYKNWVKAGHCLLLLRSCLQGFVGREVLSFHRGLLAAAPGLGPRAVCRGGSRCSPRARQFQPQCQVCAEWKREILRHHVNRNGDVHWGNCRPGRWPVDAWEVAKAFMPRGLADKQGPEECDAVALLSLINSCDHFVVDRKKVTEVIKCRNEIMHSSEMKVSSTWLRDFQMKIQNFLNEFKNIPEIVAVYSRIEQLLTSDWAVHIPEEDQRDGCECEMGTYLSESQVNEIEMQLLKEKLQEIYLQAEEQEVLPEELSNRLEVVKEFLRNNEDLRNGLTEDMQKLDSLCLHQKLDSQEPGRQTPDRKA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CXorf38 chromosome X open reading frame 38 [ Homo sapiens ]
Official Symbol CXorf38
Synonyms CXORF38; chromosome X open reading frame 38; uncharacterized protein CXorf38; MGC39350;
Gene ID 159013
mRNA Refseq NM_144970
Protein Refseq NP_659407
UniProt ID Q8TB03

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CXorf38 Products

Required fields are marked with *

My Review for All CXorf38 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon