Recombinant Human CXorf38 Protein, GST-tagged
Cat.No. : | CXorf38-2192H |
Product Overview : | Human CXorf38 full-length ORF ( NP_659407.1, 1 a.a. - 319 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CXorf38 (Chromosome X Open Reading Frame 38) is a Protein Coding gene. |
Molecular Mass : | 63.1 kDa |
AA Sequence : | MVLSELAARLNCAEYKNWVKAGHCLLLLRSCLQGFVGREVLSFHRGLLAAAPGLGPRAVCRGGSRCSPRARQFQPQCQVCAEWKREILRHHVNRNGDVHWGNCRPGRWPVDAWEVAKAFMPRGLADKQGPEECDAVALLSLINSCDHFVVDRKKVTEVIKCRNEIMHSSEMKVSSTWLRDFQMKIQNFLNEFKNIPEIVAVYSRIEQLLTSDWAVHIPEEDQRDGCECEMGTYLSESQVNEIEMQLLKEKLQEIYLQAEEQEVLPEELSNRLEVVKEFLRNNEDLRNGLTEDMQKLDSLCLHQKLDSQEPGRQTPDRKA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CXorf38 chromosome X open reading frame 38 [ Homo sapiens ] |
Official Symbol | CXorf38 |
Synonyms | CXORF38; chromosome X open reading frame 38; uncharacterized protein CXorf38; MGC39350; |
Gene ID | 159013 |
mRNA Refseq | NM_144970 |
Protein Refseq | NP_659407 |
UniProt ID | Q8TB03 |
◆ Recombinant Proteins | ||
CXorf38-2342HF | Recombinant Full Length Human CXorf38 Protein, GST-tagged | +Inquiry |
CXorf38-2192H | Recombinant Human CXorf38 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXorf38-209HCL | Recombinant Human CXorf38 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXorf38 Products
Required fields are marked with *
My Review for All CXorf38 Products
Required fields are marked with *