Recombinant Full Length Human CXorf58 Protein, GST-tagged
| Cat.No. : | CXorf58-2356HF | 
| Product Overview : | Human CXorf58 full-length ORF ( ADR83134.1, 1 a.a. - 332 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 332 amino acids | 
| Description : | CXorf58 (Chromosome X Open Reading Frame 58) is a Protein Coding gene. Diseases associated with CXorf58 include Retinitis Pigmentosa 11. | 
| Molecular Mass : | 36.6 kDa | 
| AA Sequence : | MNRSSNVPRKGILKSGTRSLQKVCRVHFANARNARSLLSMLKDISAQIIQRAWLSHTNKMIFRLLKHAICAAEFYVTHEILKKVAPLEAKLIKDPTMQCKIRFRFRGETFPPFIVFKIFLHTDGHGYKYFSGKNVLMPSSKAVDDACKLMGERKFHRIIMEDERIFPKSKVTDIMDVVTMQDYVQYRSFFDEAPAFSGGRNNSWRKLNLENIPRTMLMYDIVHYSESGVISNRLRNEMKFLLQRPVTQEIHKHQLRIVSEIRGPYLTVQPLYRPYKQQNQVKFLGRRSKQAQMKVEKMRKVYLAKEKNTSEVTEPKTGPSGTKDNYHLHSIF | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CXorf58 chromosome X open reading frame 58 [ Homo sapiens ] | 
| Official Symbol | CXorf58 | 
| Synonyms | CXORF58; chromosome X open reading frame 58; putative uncharacterized protein CXorf58; FLJ25444; | 
| Gene ID | 254158 | 
| mRNA Refseq | NM_001169574 | 
| Protein Refseq | NP_001163045 | 
| UniProt ID | Q96LI9 | 
| ◆ Recombinant Proteins | ||
| CXorf58-2356HF | Recombinant Full Length Human CXorf58 Protein, GST-tagged | +Inquiry | 
| CXorf58-2200H | Recombinant Human CXorf58 Protein, GST-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXorf58 Products
Required fields are marked with *
My Review for All CXorf58 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            