Recombinant Full Length Human CXorf58 Protein, GST-tagged
Cat.No. : | CXorf58-2356HF |
Product Overview : | Human CXorf58 full-length ORF ( ADR83134.1, 1 a.a. - 332 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 332 amino acids |
Description : | CXorf58 (Chromosome X Open Reading Frame 58) is a Protein Coding gene. Diseases associated with CXorf58 include Retinitis Pigmentosa 11. |
Molecular Mass : | 36.6 kDa |
AA Sequence : | MNRSSNVPRKGILKSGTRSLQKVCRVHFANARNARSLLSMLKDISAQIIQRAWLSHTNKMIFRLLKHAICAAEFYVTHEILKKVAPLEAKLIKDPTMQCKIRFRFRGETFPPFIVFKIFLHTDGHGYKYFSGKNVLMPSSKAVDDACKLMGERKFHRIIMEDERIFPKSKVTDIMDVVTMQDYVQYRSFFDEAPAFSGGRNNSWRKLNLENIPRTMLMYDIVHYSESGVISNRLRNEMKFLLQRPVTQEIHKHQLRIVSEIRGPYLTVQPLYRPYKQQNQVKFLGRRSKQAQMKVEKMRKVYLAKEKNTSEVTEPKTGPSGTKDNYHLHSIF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CXorf58 chromosome X open reading frame 58 [ Homo sapiens ] |
Official Symbol | CXorf58 |
Synonyms | CXORF58; chromosome X open reading frame 58; putative uncharacterized protein CXorf58; FLJ25444; |
Gene ID | 254158 |
mRNA Refseq | NM_001169574 |
Protein Refseq | NP_001163045 |
UniProt ID | Q96LI9 |
◆ Recombinant Proteins | ||
CXorf58-2200H | Recombinant Human CXorf58 Protein, GST-tagged | +Inquiry |
CXorf58-2356HF | Recombinant Full Length Human CXorf58 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXorf58 Products
Required fields are marked with *
My Review for All CXorf58 Products
Required fields are marked with *