Recombinant Human CXorf58 Protein, GST-tagged

• Cat.No.: CXorf58-2200H
• Product Overview: Human CXorf58 full-length ORF ( ADR83134.1, 1 a.a. - 332 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CXorf58 (Chromosome X Open Reading Frame 58) is a Protein Coding gene. Diseases associated with CXorf58 include Retinitis Pigmentosa 11.
• Molecular Mass: 36.6 kDa
• AA Sequence: MNRSSNVPRKGILKSGTRSLQKVCRVHFANARNARSLLSMLKDISAQIIQRAWLSHTNKMIFRLLKHAICAAEFYVTHEILKKVAPLEAKLIKDPTMQCKIRFRFRGETFPPFIVFKIFLHTDGHGYKYFSGKNVLMPSSKAVDDACKLMGERKFHRIIMEDERIFPKSKVTDIMDVVTMQDYVQYRSFFDEAPAFSGGRNNSWRKLNLENIPRTMLMYDIVHYSESGVISNRLRNEMKFLLQRPVTQEIHKHQLRIVSEIRGPYLTVQPLYRPYKQQNQVKFLGRRSKQAQMKVEKMRKVYLAKEKNTSEVTEPKTGPSGTKDNYHLHSIF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CXorf58 chromosome X open reading frame 58 [ Homo sapiens ]
• Official Symbol: CXorf58
• Synonyms: CXORF58; chromosome X open reading frame 58; putative uncharacterized protein CXorf58; FLJ25444
• Gene ID: 254158
• mRNA Refseq: NM_001169574
• Protein Refseq: NP_001163045
• UniProt ID: Q96LI9