Recombinant Human CXorf58 Protein, GST-tagged

Cat.No. : CXorf58-2200H
Product Overview : Human CXorf58 full-length ORF ( ADR83134.1, 1 a.a. - 332 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CXorf58 (Chromosome X Open Reading Frame 58) is a Protein Coding gene. Diseases associated with CXorf58 include Retinitis Pigmentosa 11.
Molecular Mass : 36.6 kDa
AA Sequence : MNRSSNVPRKGILKSGTRSLQKVCRVHFANARNARSLLSMLKDISAQIIQRAWLSHTNKMIFRLLKHAICAAEFYVTHEILKKVAPLEAKLIKDPTMQCKIRFRFRGETFPPFIVFKIFLHTDGHGYKYFSGKNVLMPSSKAVDDACKLMGERKFHRIIMEDERIFPKSKVTDIMDVVTMQDYVQYRSFFDEAPAFSGGRNNSWRKLNLENIPRTMLMYDIVHYSESGVISNRLRNEMKFLLQRPVTQEIHKHQLRIVSEIRGPYLTVQPLYRPYKQQNQVKFLGRRSKQAQMKVEKMRKVYLAKEKNTSEVTEPKTGPSGTKDNYHLHSIF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CXorf58 chromosome X open reading frame 58 [ Homo sapiens ]
Official Symbol CXorf58
Synonyms CXORF58; chromosome X open reading frame 58; putative uncharacterized protein CXorf58; FLJ25444;
Gene ID 254158
mRNA Refseq NM_001169574
Protein Refseq NP_001163045
UniProt ID Q96LI9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXorf58 Products

Required fields are marked with *

My Review for All CXorf58 Products

Required fields are marked with *

0
cart-icon
0
compare icon