Recombinant Full Length Human CYB5A Protein, C-Flag-tagged
Cat.No. : | CYB5A-1662HFL |
Product Overview : | Recombinant Full Length Human CYB5A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a membrane-bound cytochrome that reduces ferric hemoglobin (methemoglobin) to ferrous hemoglobin, which is required for stearyl-CoA-desaturase activity. Defects in this gene are a cause of type IV hereditary methemoglobinemia. Three transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 15.1 kDa |
AA Sequence : | MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | CYB5A cytochrome b5 type A [ Homo sapiens (human) ] |
Official Symbol | CYB5A |
Synonyms | CYB5; MCB5; METAG |
Gene ID | 1528 |
mRNA Refseq | NM_148923.4 |
Protein Refseq | NP_683725.1 |
MIM | 613218 |
UniProt ID | P00167 |
◆ Recombinant Proteins | ||
RFL27014RF | Recombinant Full Length Rat Cytochrome B5(Cyb5A) Protein, His-Tagged | +Inquiry |
RFL30016SF | Recombinant Full Length Pig Cytochrome B5(Cyb5A) Protein, His-Tagged | +Inquiry |
CYB5A-2208H | Recombinant Human CYB5A Protein, GST-tagged | +Inquiry |
CYB5A-27555TH | Recombinant Human CYB5A, His-tagged | +Inquiry |
CYB5A-22H | Recombinant Human CYB5A protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CYB5A-30H | Recombinant Human CYB5A Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYB5A-7146HCL | Recombinant Human CYB5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYB5A Products
Required fields are marked with *
My Review for All CYB5A Products
Required fields are marked with *
0
Inquiry Basket