Recombinant Full Length Human CYLC2 Protein, GST-tagged

Cat.No. : CYLC2-2274HF
Product Overview : Human CYLC2 full-length ORF (BAG36151.1, 1 a.a. - 348 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 348 amino acids
Description : Cylicin II (CYCL2) is specifically expressed in testis and is part of the cytoskeletal calyx of mammalian sperm heads. Cylicin II may play a role in the morphogenesis of the sperm head. [provided by RefSeq, Jul 2008]
Molecular Mass : 64.68 kDa
AA Sequence : MSLPRFQRVNFGPYDNYIPVSELSKKSWNQQHFALLFPKPQRPGTKRRSKPSQIRDNTVSIIDEEQLRGDRRQPLWMYRSLMRISERPSVYLAARRQPLKPTRTVEVDSKAAEIGKKGEDKTTQKDTTDSESELKQGKKDSKKGKDIEKGKEEKLDAKKDSKKGKKDAEKGKDSATESEDEKGGAKKDNKKDKKDSNKGKDSATESEGEKGGTEKDSKKGKKDSKKGKDSAIELQAVKADEKKDEDGKKDANKGDESKDAKKDAKEIKKGKKDKKKPSSTDSDSKDDVKKESKKDATKDAKKVAKKDTEKESADSKKDAKKNAKKDAKKDAKKNAKKDEKKDAKKKGK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CYLC2 cylicin, basic protein of sperm head cytoskeleton 2 [ Homo sapiens ]
Official Symbol CYLC2
Synonyms CYLC2; cylicin, basic protein of sperm head cytoskeleton 2; cylicin-2; cylicin II; multiple-band polypeptide II; MGC129591
Gene ID 1539
mRNA Refseq NM_001340
Protein Refseq NP_001331
MIM 604035
UniProt ID Q14093

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYLC2 Products

Required fields are marked with *

My Review for All CYLC2 Products

Required fields are marked with *

0
cart-icon