Recombinant Human CYLC2 Protein, GST-tagged
Cat.No. : | CYLC2-2236H |
Product Overview : | Human CYLC2 full-length ORF (BAG36151.1, 1 a.a. - 348 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Cylicin II (CYCL2) is specifically expressed in testis and is part of the cytoskeletal calyx of mammalian sperm heads. Cylicin II may play a role in the morphogenesis of the sperm head. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 64.68 kDa |
AA Sequence : | MSLPRFQRVNFGPYDNYIPVSELSKKSWNQQHFALLFPKPQRPGTKRRSKPSQIRDNTVSIIDEEQLRGDRRQPLWMYRSLMRISERPSVYLAARRQPLKPTRTVEVDSKAAEIGKKGEDKTTQKDTTDSESELKQGKKDSKKGKDIEKGKEEKLDAKKDSKKGKKDAEKGKDSATESEDEKGGAKKDNKKDKKDSNKGKDSATESEGEKGGTEKDSKKGKKDSKKGKDSAIELQAVKADEKKDEDGKKDANKGDESKDAKKDAKEIKKGKKDKKKPSSTDSDSKDDVKKESKKDATKDAKKVAKKDTEKESADSKKDAKKNAKKDAKKDAKKNAKKDEKKDAKKKGK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CYLC2 cylicin, basic protein of sperm head cytoskeleton 2 [ Homo sapiens ] |
Official Symbol | CYLC2 |
Synonyms | CYLC2; cylicin, basic protein of sperm head cytoskeleton 2; cylicin-2; cylicin II; multiple-band polypeptide II; MGC129591; |
Gene ID | 1539 |
mRNA Refseq | NM_001340 |
Protein Refseq | NP_001331 |
MIM | 604035 |
UniProt ID | Q14093 |
◆ Recombinant Proteins | ||
CYLC2-2274HF | Recombinant Full Length Human CYLC2 Protein, GST-tagged | +Inquiry |
CYLC2-2236H | Recombinant Human CYLC2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYLC2-431HCL | Recombinant Human CYLC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYLC2 Products
Required fields are marked with *
My Review for All CYLC2 Products
Required fields are marked with *
0
Inquiry Basket