Recombinant Human CYLC2 Protein, GST-tagged
| Cat.No. : | CYLC2-2236H |
| Product Overview : | Human CYLC2 full-length ORF (BAG36151.1, 1 a.a. - 348 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Cylicin II (CYCL2) is specifically expressed in testis and is part of the cytoskeletal calyx of mammalian sperm heads. Cylicin II may play a role in the morphogenesis of the sperm head. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 64.68 kDa |
| AA Sequence : | MSLPRFQRVNFGPYDNYIPVSELSKKSWNQQHFALLFPKPQRPGTKRRSKPSQIRDNTVSIIDEEQLRGDRRQPLWMYRSLMRISERPSVYLAARRQPLKPTRTVEVDSKAAEIGKKGEDKTTQKDTTDSESELKQGKKDSKKGKDIEKGKEEKLDAKKDSKKGKKDAEKGKDSATESEDEKGGAKKDNKKDKKDSNKGKDSATESEGEKGGTEKDSKKGKKDSKKGKDSAIELQAVKADEKKDEDGKKDANKGDESKDAKKDAKEIKKGKKDKKKPSSTDSDSKDDVKKESKKDATKDAKKVAKKDTEKESADSKKDAKKNAKKDAKKDAKKNAKKDEKKDAKKKGK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CYLC2 cylicin, basic protein of sperm head cytoskeleton 2 [ Homo sapiens ] |
| Official Symbol | CYLC2 |
| Synonyms | CYLC2; cylicin, basic protein of sperm head cytoskeleton 2; cylicin-2; cylicin II; multiple-band polypeptide II; MGC129591; |
| Gene ID | 1539 |
| mRNA Refseq | NM_001340 |
| Protein Refseq | NP_001331 |
| MIM | 604035 |
| UniProt ID | Q14093 |
| ◆ Recombinant Proteins | ||
| CYLC2-2236H | Recombinant Human CYLC2 Protein, GST-tagged | +Inquiry |
| CYLC2-2274HF | Recombinant Full Length Human CYLC2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CYLC2-431HCL | Recombinant Human CYLC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYLC2 Products
Required fields are marked with *
My Review for All CYLC2 Products
Required fields are marked with *
