Recombinant Full Length Human CYP2S1 Protein, C-Flag-tagged
Cat.No. : | CYP2S1-1451HFL |
Product Overview : | Recombinant Full Length Human CYP2S1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. In rodents, the homologous protein has been shown to metabolize certain carcinogens; however, the specific function of the human protein has not been determined. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 55.6 kDa |
AA Sequence : | MEATGTWALLLALALLLLLTLALSGTRARGHLPPGPTPLPLLGNLLQLRPGALYSGLMRLSKKYGPVFTI YLGPWRPVVVLVGQEAVREALGGQAEEFSGRGTVAMLEGTFDGHGVFFSNGERWRQLRKFTMLALRDLGM GKREGEELIQAEARCLVETFQGTEGRPFDPSLLLAQATSNVVCSLLFGLRFSYEDKEFQAVVRAAGGTLL GVSSQGGQTYEMFSWFLRPLPGPHKQLLHHVSTLAAFTVRQVQQHQGNLDASGPARDLVDAFLLKMAQEE QNPGTEFTNKNMLMTVIYLLFAGTMTVSTTVGYTLLLLMKYPHVQKWVREELNRELGAGQAPSLGDRTRL PYTDAVLHEAQRLLALVPMGIPRTLMRTTRFRGYTLPQGTEVFPLLGSILHDPNIFKHPEEFNPDRFLDA DGRFRKHEAFLPFSLGKRVCLGEGLAKAELFLFFTTILQAFSLESPCPPDTLSLKPTVSGLFNIPPAFQL QVRPTDLHSTTQTRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, P450, Transmembrane |
Protein Pathways : | Metabolism of xenobiotics by cytochrome P450 |
Full Length : | Full L. |
Gene Name | CYP2S1 cytochrome P450 family 2 subfamily S member 1 [ Homo sapiens (human) ] |
Official Symbol | CYP2S1 |
Synonyms | CYPIIS1 |
Gene ID | 29785 |
mRNA Refseq | NM_030622.8 |
Protein Refseq | NP_085125.1 |
MIM | 611529 |
UniProt ID | Q96SQ9 |
◆ Recombinant Proteins | ||
CYP2S1-1451HFL | Recombinant Full Length Human CYP2S1 Protein, C-Flag-tagged | +Inquiry |
CYP2S1-4201M | Recombinant Mouse CYP2S1 Protein | +Inquiry |
CYP2S1-704H | Recombinant Human CYP2S1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYP2S1-2150M | Recombinant Mouse CYP2S1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cyp2s1-2419M | Recombinant Mouse Cyp2s1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP2S1-7108HCL | Recombinant Human CYP2S1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP2S1 Products
Required fields are marked with *
My Review for All CYP2S1 Products
Required fields are marked with *
0
Inquiry Basket