Recombinant Full Length Human CYP4V2 Protein, GST-tagged
Cat.No. : | CYP4V2-2462HF |
Product Overview : | Human CYP4V2 full-length ORF ( NP_997235.2, 1 a.a. - 525 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 525 amino acids |
Description : | This gene encodes a member of the cytochrome P450 hemethiolate protein superfamily which are involved in oxidizing various substrates in the metabolic pathway. It is implicated in the metabolism of fatty acid precursors into n-3 polyunsaturated fatty acids. Mutations in this gene result in Bietti crystalline corneoretinal dystrophy. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 87.1 kDa |
AA Sequence : | MAGLWLGLVWQKLLLWGAASALSLAGASLVLSLLQRVASYARKWQQMRPIPTVARAYPLVGHALLMKPDGREFFQQIIEYTEEYRHMPLLKLWVGPVPMVALYNAENVEVILTSSKQIDKSSMYKFLEPWLGLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKHINQEAFNCFFYITLCALDIICETAMGKNIGAQSNDDSEYVRAVYRMSEMIFRRIKMPWLWLDLWYLMFKEGWEHKKSLKILHTFTNSVIAERANEMNANEDCRGDGRGSAPSKNKRRAFLDLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHFWIESNQKREELGLEGQLILRPSNGIWIKLKRRNADER |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CYP4V2 cytochrome P450, family 4, subfamily V, polypeptide 2 [ Homo sapiens ] |
Official Symbol | CYP4V2 |
Synonyms | CYP4V2; cytochrome P450, family 4, subfamily V, polypeptide 2; cytochrome P450 4V2; CYP4AH1; BCD; FLJ18432; MGC43534; |
Gene ID | 285440 |
mRNA Refseq | NM_207352 |
Protein Refseq | NP_997235 |
MIM | 608614 |
UniProt ID | Q6ZWL3 |
◆ Recombinant Proteins | ||
CYP4V2-1179C | Recombinant Chicken CYP4V2 | +Inquiry |
CYP4V2-2462HF | Recombinant Full Length Human CYP4V2 Protein, GST-tagged | +Inquiry |
RFL36768HF | Recombinant Full Length Human Cytochrome P450 4V2(Cyp4V2) Protein, His-Tagged | +Inquiry |
RFL16376MF | Recombinant Full Length Mouse Cytochrome P450 4V2(Cyp4V2) Protein, His-Tagged | +Inquiry |
RFL34569PF | Recombinant Full Length Pongo Abelii Cytochrome P450 4V2(Cyp4V2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP4V2-440HCL | Recombinant Human CYP4V2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYP4V2 Products
Required fields are marked with *
My Review for All CYP4V2 Products
Required fields are marked with *