Recombinant Full Length Human CYSLTR1 Protein

Cat.No. : CYSLTR1-2488HF
Product Overview : Human CYSLTR1 full-length ORF (NP_006630.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 337 amino acids
Description : This gene encodes a member of the G-protein coupled receptor 1 family. The encoded protein is a receptor for cysteinyl leukotrienes, and is involved in mediating bronchoconstriction via activation of a phosphatidylinositol-calcium second messenger system. Activation of the encoded receptor results in contraction and proliferation of bronchial smooth muscle cells, eosinophil migration, and damage to the mucus layer in the lung. Upregulation of this gene is associated with asthma and dysregulation may also be implicated in cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
Form : Liquid
Molecular Mass : 38.5 kDa
AA Sequence : MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name CYSLTR1 cysteinyl leukotriene receptor 1 [ Homo sapiens ]
Official Symbol CYSLTR1
Synonyms CYSLTR1; cysteinyl leukotriene receptor 1; CysLT(1); CysLT1; CYSLT1R; LTD4 receptor; G-protein coupled receptor HG55; cysteinyl leukotriene D4 receptor; HG55; CYSLT1; CYSLTR; HMTMF81; MGC46139;
Gene ID 10800
mRNA Refseq NM_006639
Protein Refseq NP_006630
MIM 300201
UniProt ID Q9Y271

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYSLTR1 Products

Required fields are marked with *

My Review for All CYSLTR1 Products

Required fields are marked with *

0
cart-icon
0
compare icon