Recombinant Full Length Human DAAM2 Protein, GST-tagged
Cat.No. : | DAAM2-2518HF |
Product Overview : | Human DAAM2 full-length ORF ( AAH47575.1, 1 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 132 amino acids |
Description : | DAAM2 (Dishevelled Associated Activator Of Morphogenesis 2) is a Protein Coding gene. Diseases associated with DAAM2 include Intestinal Volvulus. Among its related pathways are Wnt Signaling Pathway and Pluripotency and WNT Signaling. GO annotations related to this gene include binding and Rho GTPase binding. An important paralog of this gene is DAAM1. |
Molecular Mass : | 41.3 kDa |
AA Sequence : | MAPRKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAELVDELDLTDKNREAMFALPPEKKWQIYCSKKKVPSLTPLATSQGSWHGVALAALACSCIHLMFITCQPCSRCWRNNSE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DAAM2 dishevelled associated activator of morphogenesis 2 [ Homo sapiens ] |
Official Symbol | DAAM2 |
Synonyms | DAAM2; dishevelled associated activator of morphogenesis 2; disheveled-associated activator of morphogenesis 2; KIAA0381; dishevelled-associated activator of morphogenesis 2; dJ90A20A.1; RP1-278E11.1; MGC90515; |
Gene ID | 23500 |
mRNA Refseq | NM_001201427 |
Protein Refseq | NP_001188356 |
MIM | 606627 |
UniProt ID | Q86T65 |
◆ Recombinant Proteins | ||
Daam2-1305R | Recombinant Rat Daam2 Protein, His-tagged | +Inquiry |
DAAM2-2190M | Recombinant Mouse DAAM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DAAM2-4285M | Recombinant Mouse DAAM2 Protein | +Inquiry |
DAAM2-2313H | Recombinant Human DAAM2 Protein, GST-tagged | +Inquiry |
DAAM2-1304H | Recombinant Human DAAM2 Protein, His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DAAM2-214HCL | Recombinant Human DAAM2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DAAM2 Products
Required fields are marked with *
My Review for All DAAM2 Products
Required fields are marked with *
0
Inquiry Basket