Recombinant Full Length Human DBNL Protein, C-Flag-tagged
Cat.No. : | DBNL-768HFL |
Product Overview : | Recombinant Full Length Human DBNL Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables cadherin binding activity. Predicted to be involved in several processes, including Rac protein signal transduction; nervous system development; and podosome assembly. Located in cytoplasm. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 48.1 kDa |
AA Sequence : | MAANLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSGKVMYAFCRVK DPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANY SFHKESGRFQDVGPQAPVGSVYQKTNAVSEIKRVGKDSFWAKAEKEEENRRLEEKRRAEEAQRQLEQERR ERELREAARREQRYQEQGGEASPQSRTWEQQQEVVSRNRNEQESAVHPREIFKQKERAMSTTSISSPQPG KLRSPFLQKQLTQPETHFGREPAAAISRPRADLPAEEPAPSTPPCLVQAEEEAVYEEPPEQETFYEQPPL VQQQGAGSEHIDHHIQGQGLSGQGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGHFG MFPANYVELIETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | DBNL drebrin like [ Homo sapiens (human) ] |
Official Symbol | DBNL |
Synonyms | ABP1; HIP55; SH3P7; HIP-55 |
Gene ID | 28988 |
mRNA Refseq | NM_014063.7 |
Protein Refseq | NP_054782.2 |
MIM | 610106 |
UniProt ID | Q9UJU6 |
◆ Recombinant Proteins | ||
DBNL-4322M | Recombinant Mouse DBNL Protein | +Inquiry |
DBNL-2602HF | Recombinant Full Length Human DBNL Protein, GST-tagged | +Inquiry |
DBNL-29323TH | Recombinant Human DBNL, His-tagged | +Inquiry |
DBNL-1783R | Recombinant Rat DBNL Protein | +Inquiry |
DBNL-978H | Recombinant Human DBNL Protein,DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DBNL-7063HCL | Recombinant Human DBNL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DBNL Products
Required fields are marked with *
My Review for All DBNL Products
Required fields are marked with *
0
Inquiry Basket