Recombinant Full Length Human DCTN5 Protein, GST-tagged

Cat.No. : DCTN5-2404HF
Product Overview : Human DCTN5 full-length ORF ( ADZ15660.1, 1 a.a. - 182 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 182 amino acids
Description : This gene encodes a subunit of dynactin, a component of the cytoplasmic dynein motor machinery involved in minus-end-directed transport. The encoded protein is a component of the pointed-end subcomplex and is thought to bind membranous cargo. A pseudogene of this gene is located on the long arm of chromosome 1. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011]
Molecular Mass : 20.1 kDa
AA Sequence : MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DCTN5 dynactin 5 (p25) [ Homo sapiens ]
Official Symbol DCTN5
Synonyms DCTN5; dynactin 5 (p25); dynactin subunit 5; MGC3248; p25; dynactin 4; dynactin subunit p25;
Gene ID 84516
mRNA Refseq NM_001199011
Protein Refseq NP_001185940
MIM 612962
UniProt ID Q9BTE1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DCTN5 Products

Required fields are marked with *

My Review for All DCTN5 Products

Required fields are marked with *

0
cart-icon
0
compare icon